KEGG   Drosophila virilis: Dvir_GJ24600Help
Entry
Dvir_GJ24600      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
dvi  Drosophila virilis
Pathway
dvi00230  Purine metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dvir_GJ24600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dvi01001]
    Dvir_GJ24600
Enzymes [BR:dvi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dvir_GJ24600
Protein kinases [BR:dvi01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   Dvir_GJ24600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 6629998
NCBI-ProteinID: XP_002054711
FlyBase: FBgn0211678
UniProt: B4LZR2
Position
Unknown
AA seq 1722 aa AA seqDB search
MKLTICQIAKLFLLLTAFFFLNSHNASSTFTALNLTSGHFNSSSISSSTPTLSPFQPATT
SADIVSKTASNATATTAATSTPTTATARAAAAAAITLSSNSILVTATATTKTTATTKTTA
GQQRQLQLEHEQEQQRNALELDRQARQKQMSGIQQQQAQQGQQRQRRGKQQQQQPQQQQQ
QQQQEATTTALAAQRVAVLIPSSFDVDMMQVQQGFQHFVEFFQVHLSNASVDFLRDVDLS
GFIKLLELPKYTSIVKTLNTGINVGTGVDLDDGGVDPTKQSRQQRAQTNPLSADSLSAST
PEGQQRKHQKQQRKDESQEKHSTTRSWTHCHQLADQLAHDYNKSVVFWPCPRMKISSNFL
PSFEAIALAVRSIASKLNWTQVDIYVGDDNWGLPLAIATNLHIPYRIEIGDTMRDLHEQE
KPGKAIIITAPLNDESTLRWLGTGKWAKQDQHTKVLLIDIVASSLNVEHRLYKYLARINA
ATGNGNGNGNSNGNSHGNGNGNGSSIPQLPVSGLVTSNLLVLTLLSDKHRHFLNAAGIGM
AMVHNFRTPASGHAVNGVETPMEALAHQNASLNKLRPFMNLFSLYDLLLSHIAAASATAA
TPKYDFLVLDIVVDAALATYKWRPLLILEGGKGAGHGSYITHSIQPGYDEWLLVSSVQMW
HCGAICWTIAAICMGLLVIIVVASVAAGVAVRNYFLRKRLSKGPNKIVLSASDFVFPVDS
RRVDEGIEAMLCCWLQQLQEFGGPEVDKPDLLKGSIGSLKNLGFVIPGATAAANNGAITG
AGGSTTTATINGKSGSTATGSLARHKPAHLDMRARYNGDLVQLKEINLNGSTELRSKAMD
LLVMAHGLRHENINPLIGWLSDPNRTAMVFDYCSRGSLQDVLIMDEIKLDWSFRLSLLTD
LVRGMRYLHASPLRIHGALTSRNCVVDARWVLKVTDYGLNSFYESQGLSPPPRSTKELLW
TAPELLRSMKTQQQQHHHHHNQHGRVQLGTQLGDVYSFGIIMQEVVVRGEPYCMLSLSPD
DIIAKIKKPPPLIRPSVSKGAAPPEAINIMRQCWAEQPEMRPDFNSVYERFKMLNHGRKV
NFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLIRMLPSSVAEKLKMGLAVDPE
EFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVV
SGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPR
YCLFGDTVNTASRMESTGSSWRIHMSQETRDRLEARGGYSIEPRGLIDIKGKGMMNTFWL
LGRKGFDKPLPVPPPIGESHGLDESLIRNSITLKAQANKSRTSTNPSSSQSSSLAGESVE
VKVEITPPANTDMCSSHLPNSYSLDSNSPNTISPNPTLCPEFPSKTPSSTSPQSRKLSEL
TPDSLLNPNSFNRLPSSTGGSSSRLYKKIEEMMDLSSPYNHYKCLSPSESNLSQFYDGKY
LYGNAGGGNVAGATGSGSGGCSISGSASKFDSKPGSSRLLRRQFSLDRDDQQAKVEQQHQ
LSLQANNYAALMFASKNSMLEIPMLHDTSRSPKGTLTRAHKQNSNSIAQDLEKIEEIPLS
PASSQHHSSLDSNLNRSPPSTLEAQSPPMLPMPAPATQLSPPLLSAPTSPAPSRTLNGLD
AHSRSSKNNNNNSSSSGSPNAPQETARPGPEVVLNVEQLLGR
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacaatttgtcaaattgctaaattatttctgctgttgacagccttcttcttt
cttaattcccataacgcctcatccaccttcaccgccttgaacctcacctctggccacttc
aacagcagcagcatcagcagctcgacaccaaccctctcaccattccagccggccacaacg
tcagctgacattgtgtccaagacagcgtccaatgcgactgcaacaaccgcggcaacgtca
acaccgacgacagcaacagcaagagcggcagcagcagcagcaataacgcttagcagcaat
tcaattttggtcacagcaacagcaacaactaaaacaacagcaacaactaaaacaacagca
ggacagcagagacaactacaactagaacacgaacaagaacaacaacgtaatgcgctcgaa
cttgatcgtcaggcacgtcaaaagcaaatgtccggaatacaacaacaacaggcgcaacag
gggcaacaacgtcaacgccgaggaaaacagcaacagcagcaaccacaacaacaacaacaa
caacaacagcaagaagcaaccactacagctttggcggctcagcgtgtcgcagttttaata
ccttcatcattcgacgttgatatgatgcaagtgcaacaaggctttcagcatttcgttgag
ttttttcaagtgcatttatctaatgccagcgtcgattttctacgtgatgtcgatttaagt
ggcttcattaaattactcgagctacccaaatacacgagcattgtaaagactttaaatacg
ggcattaatgtaggcaccggcgtggaccttgatgatggtggagttgacccaacaaagcag
tcgcgtcagcagcgagcccaaacgaatccgttgtcagcagactctttatcagcatctaca
ccagagggccaacagaggaaacatcaaaaacaacagcgaaaggacgagtcgcaggagaag
cactcaactacccgcagctggacccactgtcatcagctggccgaccaacttgctcacgat
tacaacaagagcgtcgtattttggccatgtccacggatgaaaatctcgagcaattttctg
ccatcattcgaggcaattgccctggccgtgcggagcattgccagcaagttgaattggacg
caggttgacatctatgttggcgacgacaattggggcctaccgctagccattgcgaccaac
ttgcatataccttatcgcattgaaattggcgacacaatgcgtgacctgcatgaacaggaa
aagccgggcaaagcaattattattacggcgcctctgaacgatgagagcaccctgcgttgg
cttgggactggcaagtgggcgaaacaggaccagcacacaaaagtattgctcatcgatatt
gtggccagctcattgaatgtcgagcaccgactctacaaatatttggcacgcatcaatgcg
gccactggcaatggtaatggtaatggcaacagcaatggcaacagccatggcaatggcaat
ggcaatgggagcagcataccgcagttgcccgtgtccgggctggtgaccagcaatctgttg
gtgctgacgctgctaagcgataagcatcgacactttctgaatgcggccgggattggcatg
gccatggtgcacaattttcgtacaccagcgtctggccatgcggtgaatggagtggagacg
ccaatggaggcattggctcatcaaaatgccagcctcaacaagctgcgaccctttatgaat
ctgttctcgctttacgatctgttgctgtcgcacattgcggctgccagtgcaacggcggca
acaccgaaatacgattttttagttctggacattgttgtggatgctgctcttgccacatac
aaatggcggccgttgcttatactggagggcggcaagggtgcaggtcatggcagttacata
acgcactccattcagcccggatacgatgaatggctgttggtcagcagcgttcaaatgtgg
cattgtggcgccatctgttggacaatcgcagcaatatgcatgggcttactggtcatcatt
gtggttgccagcgtggctgctggcgtagccgtgagaaactactttttacgcaaaagactg
tcgaaggggcccaacaagattgtgctctcggccagtgactttgtgtttccagtggactcc
cgtcgtgtggacgagggcatcgaggcgatgctctgctgctggctgcaacagctacaggaa
tttggaggtcccgaggtggacaagccagatctgctcaagggttccattggctcgctcaag
aatttgggttttgtcatacccggcgcaacagcagctgccaataacggtgccataactgga
gctgggggaagcaccacaacggcgactatcaatggcaagagtggctccacggccacgggc
agcctggcgcgtcataagccggcacatctggacatgcgggcgcgctacaatggcgatctg
gtacagctcaaagagatcaacttgaatggatccacagagctacgctccaaggccatggat
ctgttggtgatggcgcacgggctgcgccacgaaaatataaatccactaattggctggctt
tcggatccgaatcgcaccgccatggtttttgactattgctcgcgtggctcactgcaggat
gtgcttattatggatgagattaagctggactggtccttccgcctaagtctgctcacggat
ctggtgcgcggcatgcgctacctgcacgcttctccgcttcgcatccatggtgcattgacg
tccagaaattgtgtcgtggacgccagatgggtgcttaaggtaaccgactatggtctgaat
tccttttacgagtcgcagggcttgtcgcccccaccacgcagcaccaaggaactactgtgg
acggcgcccgagctgctgcgcagcatgaaaacgcaacaacagcagcatcatcatcatcat
aatcaacacggacgtgtgcagctgggcacacagctgggcgacgtctactccttcggcatc
attatgcaggaggtggttgtacgtggtgagccctattgcatgctctcactatcgccggac
gacattatagccaaaatcaaaaagccaccgccactgataaggccctcagtgtccaaaggg
gctgccccacctgaggccatcaacataatgcgacagtgttgggccgaacagcccgaaatg
cgacctgatttcaattccgtttacgagcgctttaagatgctcaatcacggacgtaaggtc
aactttgtggacacaatgttccaaatgcttgagaagtactcaaacaatctggaggagcta
atacgcgagcgcaccgagcaattggacattgaaagaaagaagactgagcagctgctaata
cgcatgttaccaagctctgttgctgagaaactaaaaatgggcctggccgtcgatcctgag
gaattctctgatgtcaccatatactttagcgacattgttggttttacaacaatcgccgca
cactgcagtcccgtgcaggtggtggatctgctcaatgacctctacacaatatttgacgca
acaatcaatgcatacaatgtctacaaggtggagaccatcggagatgcttacatggtggtc
agcgggctgccagtgaagatacccgatcatgccgagcagatagccaccatggcgctcgat
ttgctgcatcaaagcggacgcttcaatgtcaagcatctgccgggcgtgccgctccagcta
cgtattggtctgcacacgggtccctgctgtgccggcgttgtgggtctaacaatgccgcgc
tattgcctgtttggtgacacggtcaatacggcctccagaatggaatctacaggttcctcc
tggcgcattcacatgtcgcaagagacgcgcgatcgcctggaagctcgtggtggatattcc
atagagccacgcgggctcatcgatatcaaaggtaaaggcatgatgaacacgttttggttg
ctgggcagaaagggattcgacaagccgctacctgtgccaccacccatcggggagtcgcat
ggactggacgaatccctaatacgcaactcgatcacactgaaggcacaggctaacaaatcg
cgcaccagcacgaatccctcgtcatcgcagagctcttcgctggctggtgaatcggtggag
gtcaaagtggagataacaccgcctgctaacacggacatgtgctccagccatctgccaaat
tcgtactcgctggactcgaattctcccaacacgattagcccaaatccgacgctgtgcccc
gagtttcccagcaaaacgccaagcagcacaagtccacagtcgcgcaagctgtctgaactt
acgccggatagtctgctgaatccgaacagctttaatcgcttgcccagctctacgggcggg
tctagttcccgtctgtataagaagattgaggaaatgatggatctcagctcaccgtataat
cactataaatgtctcagtcccagcgagagcaacctatcccagttctatgatggcaagtat
ctgtatggaaatgctggcggtggcaacgtcgctggtgctactggatctggaagtggaggc
tgctccattagtggcagcgcctcaaagtttgatagcaagcccggctctagtcgcctgctg
cgccgtcagttcagtctggaccgtgacgaccagcaggccaaggtggagcaacagcaccag
ctgtcgctgcaggcgaacaactacgcagccctgatgtttgccagtaagaactccatgctg
gaaataccgatgctgcatgacacatcgcgcagtccgaagggcacattgacgcgggcgcac
aagcagaactctaactccattgcgcaggatctggagaagattgaggaaataccgttgtcg
ccggcctcctcgcaacaccacagcagtctggatagcaacctaaatcgaagtccgccctcc
accctggaggcccaatcgccgccgatgctacccatgcccgctccggccacccagctgagt
ccacctttgctctcggcacccacctcgccggcaccttcgcgcactctgaatggcctggat
gcgcacagccgtagcagcaagaacaataacaacaacagcagcagcagcggcagccccaat
gcgccacaggaaaccgccaggcccggtcctgaggtagtactcaacgtggagcagctgctg
ggcagatag

DBGET integrated database retrieval system