KEGG   Drosophila virilis: Dvir_GJ24659Help
Entry
Dvir_GJ24659      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dvi03019]
    Dvir_GJ24659
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     Dvir_GJ24659
Messenger RNA biogenesis [BR:dvi03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     Dvir_GJ24659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 PTS_IIA
Motif
Other DBs
NCBI-GeneID: 6631190
NCBI-ProteinID: XP_002054835
FlyBase: FBgn0211736
UniProt: B4M0H6
Position
Unknown
AA seq 614 aa AA seqDB search
MADAWDIKSLKTKRNTLREKLEKRKKERFDILSDKQEDQSNPKKELVEADVEVQKAVLQA
LSASTLVLPIVSTQVVNKVGGLMEKPPTMEMVNFILGKLANQGAIGIRNVTIGTEAGYEV
ISVQTKELLEIYDDVNDSCQQNEEKDVKRKLESGQDELSDAERLQCKMLKVDAAAGRKES
TSLDASDDIMMLLSLPSTREKQSKQVGEEILELLTKPTAKERSVAEKFKSHGGAQVMEFC
SHGTKVECLKAQQVANEMAAKKKLERREEKELRGADVSIGSSTKLTKLGTEDAEDGEIIA
DTLNNCEGESQESTDDSETSGDSDKCTKLHFKKIIQSHTDESLGDCSFLNTCFHMATCKY
VHYEVDTLPHINTNKPTDVKTKLSLKRSVDSSCTLYPPQWIQCDLRFLDMTVLGKFAVVM
ADPPWDIHMELPYGTMSDDEMRALGIPALQEEGLIFLWVTGRAMELGRDCLKLWGYERVD
ELIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPTNLNRGLDCDVIVAEVRATSHK
PDEIYGIIERLSPGTRKIELFGRPHNIQPNWITLGNQLDGIRLVDPELITQFQKRYPDGN
CMSPTAAAVNAIKN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgcgtgggacataaagtcgctcaagacaaaacgaaatacgttgcgcgaaaag
ctggagaagcgtaagaaggaacgcttcgacatactatctgacaaacaggaggatcaatcc
aatccaaaaaaggagctcgttgaagccgatgttgaggtgcaaaaggcagtactgcaggcg
ctcagtgccagcactctggtgctgccaattgtctctacacaggtggtaaataaagtcggc
ggcctcatggagaagccgccaaccatggaaatggttaacttcatattgggcaagcttgcc
aatcaaggggccatcggcataaggaatgtcacgattggcacggaagcgggctacgaggtg
atttccgtgcaaaccaaggagctcttggagatttatgacgatgtcaacgacagttgccag
cagaatgaggaaaaggatgtcaagcgaaagttagagtccggacaggatgagctgagcgat
gctgagcgtttgcagtgtaaaatgctaaaagttgatgcagctgccggccgcaaggagtcc
accagtctggatgcctcagacgacatcatgatgctgctctccctgccctcaacgcgcgag
aaacagagcaaacaggttggcgaggagattctcgagctgctgacgaagccaacggccaaa
gagcgctccgtagctgaaaagtttaaatcccatggcggtgcacaagtcatggagttttgc
tcacatggcaccaaggtcgagtgtctcaaggcacagcaggtggccaacgagatggcggcc
aaaaagaaactcgaacgtcgcgaggagaaggaattgcgcggcgctgatgtgtccattggc
agcagcaccaagctgaccaagctgggtaccgaggatgccgaagatggtgaaatcattgcc
gacaccctaaacaactgtgagggtgaatcgcaggagtctacggatgacagcgaaacttcc
ggcgactcggacaaatgcacaaagttgcactttaagaaaatcattcagtcgcacacggac
gagtctctgggcgattgcagtttccttaatacctgcttccacatggccacctgcaagtac
gtccattatgaggtggacacgctgccgcacattaataccaataagccgacggatgtgaag
accaagctcagcctgaagcgcagcgttgactccagctgcactttgtatccgccgcagtgg
atacagtgcgatctgcgatttctggacatgactgtgctgggcaaatttgctgtcgttatg
gccgatccgccatgggacatacacatggagctgccctatggcaccatgtccgacgatgag
atgcgcgccttgggcataccagcgctgcaggaggagggtctcatatttctctgggtaact
gggcgcgccatggaactgggtcgcgattgcctcaaactgtggggctacgagcgcgtcgac
gagctgatctgggtgaaaacgaatcagctgcagcgcattatacgcacgggccgcaccggc
cactggctgaatcacggcaaggagcattgtttggtcggcatgaagggcaatcccacaaat
ctgaatcgcggcctcgactgcgatgtcattgtggcagaagtgcgcgccaccagtcacaag
cccgacgagatctacggcatcatcgaacgcctcagtccgggcacacgaaaaatcgagctc
ttcggccggccacacaacatacagcccaactggataacgctgggcaatcagctggatggc
atacgtctggtcgatcccgagctgattacccagttccaaaagcgttatcccgacggcaac
tgcatgtcgcccacggcggcggcggtaaatgcaattaaaaattaa

DBGET integrated database retrieval system