KEGG   Desulfovibrio vulgaris DP4: Dvul_0491
Entry
Dvul_0491         CDS       T00452                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K25261  isethionate sulfite-lyase [EC:4.4.1.38]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00430  Taurine and hypotaurine metabolism
dvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Dvul_0491
Enzymes [BR:dvl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.38  isethionate sulfite-lyase
     Dvul_0491
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABM27514
UniProt: A0A0H3A612
Position
complement(625717..628203)
AA seq 828 aa
MQCCNQLSPHEQRLQDKIEGKVDRYRATHERVFTILESFDNTRPRIDVERAKYFTESMKA
TEGQPLPLRWAKALMHIAENMTVYIDDHQLICGRAGYQGRYGVLYPELDGDFLGTAIEDL
PNRAESPFAITPEDARVVVEEIAPFWKGKTYHEALNLALPADVHKLTYDDPQGLMSRFIV
NETSSFRSSIQWVHDYEKVLKRGFRSIKEEALEKIAALDPMSPCDNVEKRPFLEAIVIVC
DAIILWAKRHAKLAAELAAKETDPTRKRELETMAEICAWVPENPARTFHEAVQAQWFTQV
FSRIEQKTGTIVSNGRMDQYFWPFYEKDLAEGRITEDSALELLECMWVGMAQYVDLYISP
TGGAFNEGYAHWEAVTIGGQTPEGRDATNDLTYLFLKSKREFPLHYPDLAARIHSRSPER
YLWEVAETIKDGSGFPKLINDEEVVPLYVSKGATFAEALDYAVSGCTEARMPNRDTYTSG
GAYINFAAALEMVLYNGKMLKYGDTDLGAHTGDPREFKTWEEFWNAYVTQHQLFLKTAFV
QQHIINNLRARHFAQPMGSSLHDLCMKHCLDLHTPQIPEGINLGYFEYMGFGTVVDSLSA
IKKLVFEDKKLTMDELIEALKCNFEGKEDIQQLLKSAPCYGNNDDYADSIACDIDALSVK
YGRRYSPELGMHNDVRYVPFTSHVPFGRVVSATPNGRKAWSALSDGSSASHGADVNGPTA
ILQSNFNSKNYGMRDRAARMLNIKFTPKCVEGEEGSQKLVSFIRTFCDLKLWHVQFNVIN
KETLLAAQRDPEKYRNLIVRIAGYSAYFVDLSPDLQNDLIARTGHDVM
NT seq 2487 nt   +upstreamnt  +downstreamnt
atgcaatgctgcaaccagctttcgccccatgaacagcgccttcaggacaagatcgaaggc
aaggtcgaccgctaccgtgcaacccacgagcgcgtgttcaccatccttgaaagcttcgac
aacacccgcccccgcatcgacgtggagcgcgccaagtacttcaccgaatccatgaaggcc
accgaaggccagcccctgcccctgcgctgggccaaggcgctgatgcacatcgccgagaac
atgaccgtgtacatcgacgaccatcagctcatctgcggtcgcgccgggtatcagggccgt
tacggagtgctgtaccccgaactcgacggcgacttcctcggcaccgccatcgaagacctg
cccaaccgcgccgaatcgcccttcgccatcacccctgaagacgcccgcgtggtcgtcgag
gagattgcccccttctggaagggcaagacctaccatgaggcgctgaacctcgcgctgccc
gcagacgtccacaagctcacctacgacgacccgcagggcctcatgtcccgcttcatcgtc
aacgagacctcgtcgttccgctcctccatccagtgggtgcacgactacgagaaggtgctc
aagcgcggcttccgcagcatcaaggaagaagccctcgagaagatcgccgctcttgatccc
atgagcccgtgcgacaacgtcgagaagcgccccttcctcgaagccatcgtcatcgtgtgc
gacgccatcatcctgtgggccaagcgccacgcgaagctcgccgcagaactcgccgccaag
gaaaccgatcccacccgcaagcgtgagcttgagaccatggccgaaatctgcgcctgggtt
cccgagaacccggcccgcaccttccacgaggccgtgcaggcccagtggttcacccaggtg
ttctcgcgcatcgaacagaagaccggcaccatcgtgtccaacggtcgcatggaccagtac
ttctggcccttctacgaaaaggacctcgccgaaggccgcatcaccgaagacagcgccctc
gaactgctcgagtgcatgtgggtgggcatggcccagtacgtcgacctgtacatctccccc
accggcggcgccttcaacgaaggctacgcccactgggaagccgtcaccatcggcgggcag
acccccgaaggacgtgacgccaccaacgacctgacctacctcttcctgaagtccaagcgc
gaattcccgctgcactaccccgaccttgcggcacgcatccactcgcgctcgcccgaacgc
tacctgtgggaagtggccgagaccatcaaggacggttccggcttccccaagctgatcaac
gacgaagaggtcgtgcccctgtacgtctccaagggagcgaccttcgccgaagccctcgac
tacgccgtctccggctgcaccgaggcacgcatgcccaaccgcgacacctacaccagcggc
ggcgcgtacatcaacttcgcggcagcgctcgagatggtgctctacaacggcaagatgctg
aagtacggcgacaccgacctcggcgcccacaccggcgacccgcgcgaattcaagacatgg
gaagagttctggaacgcctacgtcacccagcaccagctgttcctgaagaccgccttcgtg
cagcagcacatcatcaacaacctccgtgcacgccacttcgcccagcccatgggctcgtcg
ctgcacgacctgtgcatgaagcactgcctcgacctgcacaccccgcagatccccgagggc
atcaacctcggctacttcgagtacatgggcttcggcacggtggtcgactccctgtccgcc
atcaagaagctggtgttcgaagacaagaagctgaccatggatgaactcatcgaagccctg
aagtgcaacttcgaaggcaaggaagacatccagcagctgctgaagagcgccccctgctac
ggcaacaacgacgactatgccgacagcatcgcctgcgacatcgacgccctgtccgtcaag
tacggtagacgctactcgcccgaactcggcatgcacaacgacgtgcgctacgtacccttc
acctcgcacgtgcccttcggccgcgtcgtctccgcgacgcccaacggtcgcaaggcatgg
tcggccctgtcggacggttcgtcggcctcgcatggtgccgacgtgaacggccccaccgcc
atcctccagtccaacttcaactccaagaactacggcatgcgcgaccgcgccgcccgtatg
ctgaacatcaagttcacgcccaagtgcgtggaaggcgaagaaggctcgcagaagctggtg
tccttcatccgcaccttctgcgacctcaagctgtggcacgtgcagttcaacgtcatcaac
aaggagaccctgctcgccgcccagcgcgaccccgagaagtaccgcaacctcatcgtccgc
atcgcgggctacagcgcctacttcgtggacctgtcgcccgacctgcagaacgacctcatc
gcccgcaccggccacgacgtgatgtaa

DBGET integrated database retrieval system