KEGG   Desulfovibrio vulgaris DP4: Dvul_0131Help
Entry
Dvul_0131         CDS       T00452                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00520  Amino sugar and nucleotide sugar metabolism
dvl00550  Peptidoglycan biosynthesis
dvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dvul_0131
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dvul_0131
Enzymes [BR:dvl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Dvul_0131
Peptidoglycan biosynthesis and degradation proteins [BR:dvl01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Dvul_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABM27155
UniProt: A1V9N9
Position
158390..159643
Genome map
AA seq 417 aa AA seqDB search
MDKLVIEGGVPLTGTINVSGSKNAALPILMASILAEEPLTYTNVPRLRDIHTTNKLLSIL
GCPAEFEGDTVSVRPCDLKPEAPYDLVKTMRASVLCLGPLLARLGEARVALPGGCAIGAR
PVDLHLTALEKMGARFELEEGYIIGRCRKLKGAHIYFDFPTVGGTENLLMAATLAEGETI
LENAAREPEVVDLARFLIACGAKIEGHGTSVIRIQGVPRLHGCEYAIMPDRIEAGTFLVA
AGITGGELLLTGCPWEELDAVIVKLNAMGMHIEKTSEGVLAKRRNGGLRGTDVTTQPFPG
FPTDMQAQVMSLMCLAEGTSVVQENIFENRFMHVLELVRMGADIRISGRSAVVRGVKRLT
GAPVMASDLRASASLVLAGLAARGTTHVQRIYHLDRGYERIELKLNAVGARIRREAE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactggtcatcgagggcggcgtgcccctgacgggcaccatcaacgtcagcggt
tccaagaacgccgcactccccatcctcatggcctccatcctcgccgaggagcccctcacc
tacaccaacgtgccgcgtctgcgcgacattcataccaccaacaagcttctgagcattctc
ggctgcccggcagagttcgagggcgacaccgtgagcgtgcgcccctgcgacctcaagccg
gaagccccgtacgacctggtcaagaccatgcgcgcctccgtgctctgcctcggcccgctg
ctggcacgccttggcgaggcgcgggtcgccctgcccggcggctgcgccatcggcgcacgg
cccgtcgacctgcacctcaccgcgctcgagaagatgggcgcacggttcgaacttgaggaa
ggctacatcataggccgttgccgcaagctgaagggtgcgcacatctatttcgacttcccc
actgtgggcggcaccgagaacctgctcatggcggcgaccctcgccgagggcgagaccatc
ctcgagaacgccgcgcgtgaacccgaggtcgtggacctcgcccgcttcctcatcgcctgc
ggtgcaaaaatcgaagggcacggcaccagcgtcatccgcattcagggtgtgccgcgcctg
catggttgcgaatacgcgatcatgcccgaccgcatcgaggccggtacgttcctcgtggcg
gcgggcatcaccgggggcgagttgctgctcaccggttgcccgtgggaggaactcgatgcc
gtcatcgtcaagctcaatgccatggggatgcacatcgagaagacatccgaaggcgtgctg
gcgaagcgccgcaacgggggcttgcgcggtacggacgtgaccacccagcccttccccggc
ttccccaccgacatgcaggcgcaggtgatgtcgctcatgtgcctcgcagagggaacgagc
gtggtgcaggagaacatcttcgagaaccgcttcatgcatgttctcgaactggtgcgcatg
ggagccgacatccgcatctccgggcgctccgccgtggtgcgcggggtcaagcgcctcacg
ggcgccccggtcatggcctccgaccttcgggccagtgcctcgctggtgctcgccggtctt
gcggcgcggggcaccacccatgtgcagcgcatctaccacctcgaccgcggctacgaacgc
atcgaactcaaactcaacgccgtgggtgcccgcatccgccgcgaagccgaatga

DBGET integrated database retrieval system