KEGG   Desulfovibrio vulgaris DP4: Dvul_0604Help
Entry
Dvul_0604         CDS       T00452                                 

Definition
(GenBank) pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
  KO
K05396  D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dvul_0604
Enzymes [BR:dvl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Dvul_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM27627
UniProt: A0A0H3A6D2
Position
759298..760296
Genome map
AA seq 332 aa AA seqDB search
MNLAVFPRRGYVKDPTPIESCPAFSKALGGKVNIFIKRDDLLPGCAGGNKTRKLDFCMAD
ALAKGADTIITCGAVQSNHCRLTLSWAVKEGLDCHLVLEERVKGSYKPEASGNNFLFKLM
GVKSITVVPGGSNMMGEMEALAARLKEAGRTPYIIPGGASNPIGATGYVSCAQETLQQLF
DMGLKVDHMVVPSGSAGTHAGIVVGMVGNNANIPVSGINVSRTKADQEALVRKLARETAQ
RVGMSGEFPDEAVTCFDGYVGPGYSLPTESMVEAVRLLAQTEGILLDPVYSGKAMAGLVD
LVRSGYFAEGSNVLFLHTGGSPALYAYLDTFK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgctgtttttcccagacgtggctatgtcaaggaccccacccccatcgaatcg
tgtccggctttttcgaaggctctgggcggcaaggtcaacatcttcatcaagcgtgatgac
ctgctgcccggctgcgccgggggcaacaagacccgcaagctggacttctgcatggcggat
gccctcgccaagggcgctgacaccatcatcacctgcggggccgtgcagtccaaccattgc
cgcctgaccctgtcgtgggctgtcaaggaagggctcgactgccatctcgtccttgaggag
cgtgtcaagggcagctacaagcccgaagcttcgggcaacaacttcctgttcaagctcatg
ggtgtgaagagcatcaccgtcgtgcccggcggttccaacatgatgggggaaatggaagca
ctcgctgcacgcctcaaggaagcagggcgtactccctacatcatccccggtggagcatcg
aaccccatcggggccaccggctatgtctcttgcgcgcaggagaccctccagcagctcttc
gacatgggactcaaggtggatcacatggtggttcccagcggtagcgccgggacccatgcc
ggcatcgtcgtcggcatggtgggcaacaacgccaacatccctgtctccggcatcaacgtg
agccgcaccaaggccgaccaggaggcactggtgcgcaagctggcccgcgagacggcgcag
cgcgtgggcatgagtggcgagttccccgatgaagcggtgacgtgctttgacggttatgtg
gggcccggctattcgctgcccaccgagagcatggtcgaagccgtgcgtcttctggcccag
accgaaggcatactgctcgacccggtgtactcgggcaaggccatggccggtcttgtggac
ctcgtgcgtagcggctactttgccgaaggttcgaatgtgcttttcctgcacaccggtgga
tcgccagcgctttacgcctacctcgatacgttcaagtaa

DBGET integrated database retrieval system