KEGG   Desulfovibrio vulgaris DP4: Dvul_0834Help
Entry
Dvul_0834         CDS       T00452                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00010  Glycolysis / Gluconeogenesis
dvl00071  Fatty acid degradation
dvl00350  Tyrosine metabolism
dvl00625  Chloroalkane and chloroalkene degradation
dvl00626  Naphthalene degradation
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01130  Biosynthesis of antibiotics
dvl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_0834
  Lipid metabolism
   00071 Fatty acid degradation
    Dvul_0834
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dvul_0834
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dvul_0834
   00626 Naphthalene degradation
    Dvul_0834
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dvul_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABM27855
UniProt: A0A0H3A5X6
Position
1022823..1023965
Genome map
AA seq 380 aa AA seqDB search
MRITKFAIPEIIFGNGSLNHLAPCARRLGAARVLLVSDKGLEASGWVERVVDILEADGLE
WVYFNDCNSNPRDHQVHHGARVYQEERADVVIALGGGSPMDTAKGIGTIVGNGGRINDYE
GANRIMRPLPPMIFLPTTAGSGSDISQFCIITDVERRLKMSIISRSLVPNVSIIDPQVLM
TMSEELVIASAIDAFAHAVESYLSRLASPFTDHQALRAMELIMDNLMPAVERRDPAALER
LSIASTEAGMSFSNAGLGIGHSLAHSLGGMFDVMHGLVHPVLLPHVMRFNLPVSVEKLAA
IGRIVVGPRVASAECIARAGIERLHEFFSALGVPVRLGQLLPDRGVLETIARTALNDACT
VTNPREATCENLLALCEEAW
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcaccaagttcgccattcccgagatcatcttcggtaatggaagcctcaaccat
cttgcgccctgcgcacgcagactcggggctgcgcgggtgcttctcgtcagcgacaagggg
ctggaggccagcggctgggtggagcgtgtcgtggacatcctcgaagccgacggcctcgaa
tgggtgtacttcaacgactgcaactccaatccgcgagaccatcaggtgcatcacggggcg
cgggtctatcaggaagagcgtgccgacgtcgtcatcgcgctgggcggcggaagccccatg
gatacggccaagggcatcggcaccatcgtcggcaacggagggcgcatcaacgactacgag
ggggccaaccgcatcatgcggcccctgccgcccatgatctttctgcccaccacggcgggc
agcggttcggacatctcgcaattctgcatcatcaccgatgtggagcgtcggctgaagatg
tccatcatcagccggtcactggtgcccaacgtatcgatcatcgacccgcaggtgctcatg
accatgagcgaggaactcgtcatcgcctccgccatcgacgccttcgcacacgccgtcgag
tcgtacctttcgcgccttgcctctccgttcaccgaccatcaggcgttgcgtgccatggaa
ctgatcatggacaacctcatgcctgccgtggaacggcgcgaccctgccgcgctggagaga
ctcagcatcgccagcaccgaggcgggcatgtcgttcagcaacgcgggcctcggcatcggg
cattcccttgcgcactcccttggcggcatgttcgacgtcatgcacgggctggtgcacccg
gtgttgctgccgcatgtcatgcggttcaaccttccggtcagcgtggaaaagctggcggcc
atcgggcgcatcgtcgtcgggccgcgtgtcgccagtgccgagtgcatcgcgcgggcgggc
atcgaacggttgcacgagttcttctccgcgctgggggttccggtgcgtctcgggcaactg
ctgcccgacaggggcgtgctcgagaccatcgcccggacggcgctcaatgatgcctgcact
gtgaccaacccgcgcgaggccacctgcgagaacctgctcgccctgtgcgaagaggcgtgg
tga

DBGET integrated database retrieval system