KEGG   Desulfovibrio vulgaris DP4: Dvul_0952Help
Entry
Dvul_0952         CDS       T00452                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dvl  Desulfovibrio vulgaris DP4
Brite
KEGG Orthology (KO) [BR:dvl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Dvul_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABM27973
UniProt: A0A0H3A7G1
Position
complement(1168573..1169583)
Genome map
AA seq 336 aa AA seqDB search
MLEIPLLLVVIIVVALIFDFTNGAHDCANAIATVVSTKVISPKVAVIMAAGLNLFGAFLG
EEVAHTLGSGIVNTDMVMGCQALVLAALIGAIAWNLITWYFGIPSSSSHALIGGLMGAAV
AYSGFGTLNGPSIAKKILLPLVLSPLAGFAVGFLFMSLLALGLWKVSRQRVSSTFHRLQI
LSAAFMATSHGLNDAQKTMGVITLALFIFHEIDTIHVPFWVKFICASAMAAGTALGGWKI
VKTMGHRIFKLEPVHGFAAETSAALVITGASAFGAPISTTHTITACIFGVGSTKRLSAVR
WGIAGNLVVAWVLTIPASALIAALSFWLLDLMGFVQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagatacccctgctgctggtcgtcatcatcgtcgtggcgctcatcttcgacttc
accaacggcgcccacgactgtgccaacgccattgccaccgtggtctccaccaaggtcatc
tcgcccaaggtcgcggtcatcatggctgcgggcctgaaccttttcggcgcgttcctcggc
gaggaggtggcccatacgctcggttcgggcatcgtcaacaccgacatggtcatgggctgt
caggcccttgtactggcggcgctcatcggggccatcgcgtggaacctcatcacgtggtac
ttcggcatcccctcgtcgtcgtcgcacgcgctcatcggcgggctcatgggggctgccgtg
gcctactccggcttcggcacactcaacggtccttccatcgccaagaagatccttctgccc
ctcgtgctctcgccgctggcgggcttcgccgtgggttttctcttcatgtcactgctggcg
cttggcctgtggaaggtcagcaggcagcgtgtgagcagcacgttccacaggttgcagatt
ctttccgccgccttcatggccacaagccacggcctcaacgacgcccagaagaccatgggg
gtcatcaccctcgccctgttcatcttccatgagatagacaccatccacgtccccttctgg
gtcaagttcatctgtgcttccgccatggctgccggtacggccctcggggggtggaagatc
gtcaagaccatggggcaccgcatcttcaaactcgaaccggtgcacggcttcgcagcggag
acctccgccgccctcgtcatcaccggtgcctcggctttcggcgcgcccataagcaccacc
cataccatcaccgcctgcatcttcggcgtcggttccaccaagcgcctttcggcagtgcgc
tggggtatcgccggcaacctcgtggtggcatgggtgctcaccatccccgcctccgccctc
atcgccgcactcagtttctggctgctcgacctcatgggattcgtgcaatag

DBGET integrated database retrieval system