KEGG   Desulfovibrio vulgaris DP4: Dvul_2084Help
Entry
Dvul_2084         CDS       T00452                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00230  Purine metabolism
dvl01100  Metabolic pathways
Module
dvl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dvul_2084
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dvul_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 MobB AAA_18 AAA_16 AAA_25 AAA MMR_HSR1 MEDS TsaE IstB_IS21 AAA_24 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABM29100
UniProt: A0A0H3ABM5
Position
complement(2423329..2423952)
Genome map
AA seq 207 aa AA seqDB search
MGRERSGIVLVLCAPSGTGKTTLTRRLLTEFPRFAFSVSYTTRKPRNGEVDGKDYHFVTV
EAFLRLRDAGFFAEWAEVHGNFYGTPLKATLDLLDEGRDVLFDIDVQGARQLRASLQRGR
YVFIMPPSRDELEHRLRARGTDDEETIARRLANAAKELREARRFDAWIVNDDLERAYDEL
RAAYIEETLSPECRSAFLDGLLQGWND
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagaacgctccggcatcgtgctggtgctgtgcgccccttcggggaccggcaag
accaccctgaccagaaggctgctgacggagtttccgcgtttcgccttctcggtctcctac
accacgcgtaaaccccgcaatggcgaggtggacggcaaggactaccattttgtcaccgtg
gaggcgttcctgcgcctgcgcgacgccggattcttcgccgaatgggccgaagtgcacggc
aacttctacggtacgcccctcaaagccacactcgaccttcttgatgaaggccgcgacgta
ctcttcgacatcgacgtgcaaggtgcgcggcagttgcgtgcaagcctgcaacgcgggcgc
tacgtcttcatcatgccgccatcgcgcgacgaactcgagcacaggctgagggcgcgcggc
accgacgacgaggagaccatagcccgccgtctcgccaacgcggccaaggaactgcgcgag
gcgcgccgcttcgatgcgtggatagtcaacgacgacctcgaacgcgcctacgatgagttg
cgtgccgcctacatcgaggagacgctgtccccggaatgccgttcggcgttccttgacgga
ttgctgcaggggtggaacgactga

DBGET integrated database retrieval system