KEGG   Desulfovibrio vulgaris DP4: Dvul_2116Help
Entry
Dvul_2116         CDS       T00452                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00900  Terpenoid backbone biosynthesis
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01130  Biosynthesis of antibiotics
Module
dvl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dvul_2116
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Dvul_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C DUF4072 Semialdhyde_dh FCD
Motif
Other DBs
NCBI-ProteinID: ABM29132
UniProt: A1VFB6
Position
2456754..2457980
Genome map
AA seq 408 aa AA seqDB search
MIRYISAMPSPEWEHETPRTLALLGSTGSIGTSALRVVEAHPHRFRVVALAGARNVEKLA
AQAARWRPEHLGVLDAAGAAKLRDLLPAGYAPHIHIGPEGYATMATLPEAGTVLSAQVGA
AGLRATEAAARHGKVICLANKESLVLAGDIIRRHCAGSGAVILPVDSEHNAIFQALQGHD
PASVRRIILTASGGPFRGRSREDLAAVSCRDALAHPNWDMGAKITIDSATLMNKGLEVIE
ACHLYGVGIDDVGVVVHPQSIVHSLVEYEDGSQIAHLGTPDMRIAIAYCLTWPGVVDAGV
PRLDLVKAGSLTFEEPDLHSFPCLELARRAYREGRGMPVVLNAANEVAVSLFLSDRIRFL
DIPDIIARALDMHDGTTPHDIEGIEALDEATRRTVYERAGHSNTDGMA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatacgctatatctccgccatgccatcgccggaatgggagcacgagacaccgcgcaca
ctcgccctgctggggagcacaggttccatcggcaccagcgcccttcgcgtcgtcgaggca
catccgcaccgtttcagggtggtggcactggccggggcacgcaatgtggagaagctggcc
gcgcaggccgcacgatggcgtcctgaacacctcggcgtgctggatgccgcaggcgctgca
aagctgcgggacctgctgcccgccgggtacgccccgcacatccacatcggccctgaaggg
tatgccaccatggcgaccctgccggaggccggaaccgtcctctccgcacaggtgggggca
gccggactgcgcgccaccgaagcggcggcccggcatggcaaggtcatctgccttgccaac
aaggaatcgctcgtgctcgcgggggacatcatccgccgccactgcgccggaagcggcgcg
gtcatcctgcccgtcgactccgaacacaacgccatctttcaggccctgcaggggcacgac
ccggcctctgtacggcgcatcatcctcaccgcttcgggcggccccttccgcggacgttcg
agggaagaccttgccgcggtcagctgccgcgatgccctcgcacaccccaactgggacatg
ggggcgaagataaccatcgactccgccacgctcatgaacaaggggcttgaagtcatcgag
gcctgtcacctgtatggcgtgggcatcgacgacgtgggcgtggtggtgcacccgcaatcc
atcgtccactcgctggtcgaatacgaagacggttcgcagattgcgcatctcggcacaccc
gacatgcgcatcgccatcgcctattgcctcacgtggcccggcgtcgtcgacgcgggggtg
ccgcgcctcgacctcgtcaaggctggcagcttgaccttcgaggagccggacttacactct
ttcccgtgcctcgaactggcacgccgcgcctaccgggaaggacgcggcatgcccgtggtg
ctcaacgccgccaatgaggtggccgtgtccctcttcctgagcgaccgcatccgctttctc
gacatcccggacatcatcgcccgtgccctcgacatgcacgacggaaccacgccgcacgac
atcgaaggcatcgaggccctcgacgaggcgacgaggcgcaccgtgtacgaacgggccgga
cactccaacacggacggcatggcatga

DBGET integrated database retrieval system