KEGG   Desulfovibrio vulgaris DP4: Dvul_2178Help
Entry
Dvul_2178         CDS       T00452                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00340  Histidine metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Dvul_2178
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dvul_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABM29194
UniProt: A0A0H3AA32
Position
2533448..2534758
Genome map
AA seq 436 aa AA seqDB search
MPCRILTLQSEAQWPLLGDMLAGRYDPDDAVEPVVRDILTAVRSKGDEALAEYTRRFDCP
DFTPALLHVTSEEVAQAVASVPADDIAIIRQAADNIRSFHEAQKERSWFVTHDDGTILGQ
KVTPVDRAGLYVPGGKGGDTPLLSSLLMNAIPAQVAGVTSITVASPPRPDGTLNPHLLAA
AHILGITDIIRAGSAWAVAAFAFGTQTIAPVDVIAGPGNIFVTTAKRMVQGRVAIDMIAG
PSEILILADATARPDWVAADMLSQAEHDPLASSILVTTEPALAEAVTAELERQLATLPRT
DIARNALADWGAVVVVPDMDVAVAIANRVAPEHLEVLTAQPWELAGSLRHAGALFLGPYS
PEPLGDYFAGPNHVLPTMGTARFSSALSVQTFCKRTSIIAASRAFAERNADAVARLARLE
GLEAHARSAASRNSQQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccctgccgcatcctcactctccagtcagaggcgcaatggcctcttctcggcgacatg
ctcgccggacgatacgaccccgatgacgccgtcgaacccgtcgtgcgcgacatcctcacc
gccgtccgcagcaagggtgacgaagccctcgccgagtatacccgccgcttcgactgtccc
gatttcacccccgccttactgcacgtcacctcagaagaggtggcgcaggccgtggcttcc
gtccctgccgacgacatcgccatcatcagacaggcagcggataacatccgcagcttccat
gaagcgcagaaggaacggtcgtggttcgtcacccatgatgacggcaccatcctcgggcag
aaggtcacgccggtcgaccgtgccggtctttatgtgcccggcggcaaaggaggcgacacg
cccctgctgtcaagtctgctgatgaacgccatccccgctcaggtggcaggcgtcacgagc
atcaccgtagcctcgcccccgcgtcccgacggcactctcaatccgcacctgctcgccgcc
gcccacattctgggcatcaccgacatcatccgggcggggagtgcatgggccgtggcggcc
ttcgccttcggcacacagaccatcgcgcccgtggatgtcatcgccgggccgggcaacatc
ttcgtcaccactgccaagcgcatggtacagggccgcgttgccatcgacatgatagcaggc
cccagcgagattctcatcctcgccgatgcgacggcgcgccccgactgggtcgccgccgac
atgctctcgcaggccgagcacgacccgctggcctcgtccatacttgtcaccacggaacca
gcactcgccgaagccgtcactgcggaactcgaacgccagcttgccacgcttccgcgcacc
gacatcgcccgcaatgcccttgccgactggggtgccgtggtcgtcgttccagacatggat
gtcgccgtggccatcgccaaccgcgtggccccggagcatcttgaggtgctcaccgcacag
ccatgggaacttgcggggagcctgcggcacgccggggcactctttcttggcccctattct
cccgagccactcggcgactacttcgccggccccaatcacgttctgcccaccatgggcacg
gcccgcttctcttcagcgctttcggtgcagacgttctgcaagcgcaccagcatcatcgcc
gcgtcacgtgcgttcgccgagcgtaacgccgacgcggtggcgcgccttgcgcgccttgaa
ggacttgaggcccacgcccgttcggcagcatcccgcaacagccaacagtaa

DBGET integrated database retrieval system