KEGG   Desulfovibrio vulgaris DP4: Dvul_2487Help
Entry
Dvul_2487         CDS       T00452                                 

Definition
(GenBank) signal transduction histidine kinase with CheB and CheR activity
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl02020  Two-component system
dvl02030  Bacterial chemotaxis
Module
dvl_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dvul_2487
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dvul_2487
Enzymes [BR:dvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Dvul_2487
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dvul_2487
Two-component system [BR:dvl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dvul_2487
Bacterial motility proteins [BR:dvl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dvul_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest HATPase_c Response_reg PAS_4 HisKA PAS_3 PAS_10 PAS CheR_N PAS_9 ATG16 PAS_8 IncA PAS_7 Methyltransf_25 Methyltransf_12 Golgin_A5 Spc7 Fmp27_WPPW Laminin_II Methyltransf_11 DUF4201 CALCOCO1 Mnd1 EzrA Fez1 TMF_TATA_bd DUF3450 FapA DUF1664 HMMR_N
Motif
Other DBs
NCBI-ProteinID: ABM29503
UniProt: A0A0H3AB02
Position
2897670..2902277
Genome map
AA seq 1535 aa AA seqDB search
MAAPRLDISPTAPSGTLPEENAVPRQVDSHRAANGRTEHHPTTHDAVPLPLVVGIGASAG
GLEALEGLFRHMPTTTGAAFVVIQHLSPDFPSFMDELLARQTAMSIVVVQDGMCPAPDHI
YLLPPGKEMEITLDGFVLRDKSSYDNRPSMPINTFFASLAAWYGENAAGVVLSGTGTDGA
SGLEAISAAGGLVLVQLPESAAFDGMPKAAAAACRAAVLATPDEMPDILAAFISGSPLPF
EHPGLPADPASGGPAPDALQTIFTLLQRHGGLDFRDYKPATIARRIMRRIRLEQHADIEG
YARHLRDDPQAVQTLFRDLLIGVTTFFRDEAAFDTLAATVIPELFRRLGDRGEIRLWVAG
CASGEEAYSLGMLLLEAAPQFDFTGRISIFATDVHRHSLDRASAGVYTKDSLQALSPRRL
QRFFIPEGDETYRVAPELRSLVLFTQHNILADPPFTRVDLVSCRNLLIYFGVDAQERAIA
RLHMALRPGGVLFMGASETTGRLHPIFEPLDPRLRIFTKRPDTHGMTATHLVHPAVIDVH
RLATSSPQPSERQLLRDYDALLQRFAPDGMLVDDRFAVLHFFGNGASYLTQHTGRTDRPI
TDMVEGDLRLALSSALQRASTTGETARFKSIRVPGNGGDRLVDVEVMPIGNKPSDGKHYH
VALQSSHPVLIRPLVEPAATGHGTGLLASRVAELETELAETRSSLRDSIEQVHVTNEELQ
ATNEELLSANEELQATNEELHSINEELYTVNAEFERKNDQLRILGEDYAQLFDTIPIAIA
SLDESLRVRRFNAGMSAIFHLQPHDVGRPLQQIASCLVEPDNLFKSLALGLSEGGTHDSE
ARLTDGRWCQQRIHAVRDETGATEHMLLTFMDITHVKHAEAMRQEARSLDEVSRNVPGVV
FKLCAPHDGNIRVEYVGGGTVELCGLSQEEIKADPHALVALFGPDVVPHILAGISATDGE
GTPVDVEIPLHCTGGTKWVHVQATSTPARGGGTEWYGVAVDATERRYDATRMHNAADRYL
RILDHAPMLIWRSDTTGACDWFNTTWLDFTGRTMEQEYGYGWAEGVHPDDYDRCVSIYQK
AFALQQAFEMNYRLKRHDGQFRWLVDCGKPLPDLDGTFSGFIGYCYDITDAVNALESMCE
ASKRAEEANRTKSEFLANVSHELRTPLNGALGMLQLLELSSLSPEQRQYVTTAIRSGQNL
VRLLSDILDLSRIEAGKLVIEAIPCDIKELVDEVFSTFSLDATGKGITLETTIAPGTPTY
VRTDPLRLRQTLFNLVGNAVKFTEKGGVRVEFSTASMRGDAIVLFCTVRDTGPGIPEDRI
ESIFQPFTQLDGSYTRRHSGLGLGLGIVCRLMELFGGSIEVESAPNMGTAMHFAIPVGKT
RRPQGRKVKETEDEGDRHALYLLVAEDDAINRLTLTRMLEQLGHRAHAVEDGSQALQALA
EQHFDAVFLDIQMPVLDGMATLQAIRTGQVAGLPPTIPVVAVTAHAMQGDRERFMAKGAD
AYVQKPYDFTALEKALATLGRRVRPEGRTREDYSL
NT seq 4608 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaccccgtctcgacatttccccaacagcgccctccggcacgttgccggaagag
aatgccgtgcctcggcaggtcgacagccatcgcgccgcgaatgggcgtaccgagcaccac
cccaccacgcatgatgctgtgcctcttccccttgtcgtcggcataggggcctcggccggg
ggactggaagcccttgagggcctcttcaggcatatgcccaccaccaccggggccgcgttc
gtggtcatccagcatctgtcacccgatttcccaagcttcatggacgaactgctcgcccgc
cagacagccatgtccatcgtcgttgtgcaggatggcatgtgcccggcacccgaccacatc
tacctgttgccgcccggcaaggagatggagataacgctggacggtttcgtcctgcgcgac
aagtcttcatatgacaaccgcccctccatgcccatcaacaccttcttcgcctccctcgcc
gcatggtatggagagaacgccgcaggggtcgtcctttccggcaccggcaccgacggggcg
tcggggctggaggccatctccgccgccggaggtctggttctcgtccaactccccgaaagc
gcggctttcgatggcatgcccaaagcagcagccgcggcctgccgggctgccgtgcttgcc
actccagacgaaatgccggacatactcgccgccttcatatcgggctcgccacttccgttc
gaacatcccggcctgcctgccgaccccgcctccggaggccctgcccccgacgcgctgcag
accatcttcacgctgctgcaacgccatggcgggctcgactttcgcgactacaaaccggcc
accatcgcacggcgcatcatgcgccgcatccggcttgaacaacatgccgacatcgaaggt
tatgcccggcaccttcgtgacgacccgcaagcggtgcagaccctgttccgcgacctgctc
atcggggtgacgaccttcttccgggatgaagccgccttcgacacactcgccgccacagtc
ataccggaacttttcaggagactgggcgaccggggtgaaatccggctgtgggtcgccgga
tgcgccagcggcgaagaggcctattccctcgggatgctgttgctggaagccgccccgcag
ttcgatttcacggggcgcatctccatcttcgcgaccgacgtccacaggcactccctcgac
cgcgcctcggcaggggtctacacgaaagacagcctgcaggccctctcaccccgacggctg
caacgattcttcattcccgaaggtgatgagacctacagggtcgccccggagttgcggtct
ctggtgctgttcacgcagcacaacatcctcgccgacccgcccttcacccgtgtcgacctc
gtcagttgcagaaacctcctcatctatttcggggtggatgcacaggagagggccatcgcc
cggttgcatatggccctgcgccccggcggtgtcctgttcatgggagcgagcgagaccaca
ggacgcttgcatcccatcttcgaacctctcgacccgcggttacgcatcttcacgaaacgt
cccgacacccacggcatgacggcaacccatctggtgcacccggctgtcatcgacgtgcac
cgcctggccacatcctcgccacaaccctctgaacgacaactgctgcgcgactacgacgcg
cttctgcaacgtttcgccccggacggcatgcttgtggacgaccgctttgccgtgctgcat
ttcttcggcaacggggcctcatatctcacgcagcataccgggcgcaccgaccgccccatc
accgacatggtcgagggcgacttgcgccttgccctctcctccgcgctgcaacgggcttct
acgaccggggagaccgcccgcttcaagagcatccgcgtaccgggcaatggcggggaccgc
ctcgtggatgtcgaggtcatgcccatcggtaacaaaccatccgacgggaagcactaccac
gtggcgctccagtcatcgcaccctgtgctcatccggcctcttgtcgaacccgcagcgacg
gggcacggcacaggactgctggcgtcacgggtcgccgaactcgaaacggaacttgccgag
acacgttcgagcctgcgtgacagtatcgaacaggtgcacgtcaccaacgaggaattgcag
gccaccaacgaggaactgctctcggccaatgaagaactgcaggcgacgaacgaagagctt
cattccatcaatgaggaactctacaccgtcaacgccgaattcgagcgcaagaacgaccag
ctacgcattcttggagaagactacgctcaactcttcgacacgattcccatcgccatcgcc
tcgctggacgaatcgctacgggtgcggcgtttcaatgcgggcatgtctgcaatcttccac
ctgcaaccccacgatgtgggaaggccgctgcaacagatcgcctcatgccttgtggaacct
gacaatctcttcaaatcgctggctcttggcctcagtgaagggggaacacacgacagcgag
gcacgcctcacggatggcaggtggtgccagcaacgcatccatgccgtccgtgatgagaca
ggggcgacagagcatatgctgctcaccttcatggacatcacccacgtcaaacatgccgaa
gccatgcggcaggaggcacgttctcttgacgaggtctcgcgtaacgttcccggcgtggtg
ttcaagttgtgcgccccgcatgatggtaacatcagggtcgagtacgtcggcggcggaacg
gtcgagttgtgcgggctgtcgcaggaagagatcaaagccgacccgcacgcgctggtcgcc
ttgttcggcccggatgtcgtgccacatatccttgcgggcatctctgcgacagacggggaa
gggacgcctgtggatgtcgaaatccccctgcattgcacaggcggtacaaaatgggttcat
gtacaggccacctccactccggcacgggggggcggcacggaatggtacggcgttgccgtg
gacgccacggaacgacgatacgacgcgacgcgcatgcataatgccgccgacaggtatctg
cgcatcctcgaccacgcccccatgctcatctggcgtagcgacaccactggtgcatgcgac
tggttcaacaccacatggctcgacttcacgggccggaccatggaacaggagtatggctac
ggctgggccgagggagtgcaccccgacgattacgaccgttgcgtcagcatctatcagaaa
gccttcgcactccagcaggcattcgagatgaactaccgcctgaagcggcacgacggtcaa
ttccgctggctcgtcgactgcggcaagccccttcccgacctcgacggcaccttctccggt
ttcatcggctactgctatgacatcaccgatgcggtcaacgcgctggaatccatgtgcgag
gcgagcaaacgcgccgaagaggcaaatcgtaccaaaagcgagttccttgccaacgtcagc
cacgaattgcgcactccgctcaacggagcgctgggcatgttacaactgctcgaactgtcg
tccctctctcccgaacagaggcagtatgtgaccaccgccatccgttccgggcagaacctc
gtgcgactgctcagcgacatcctcgacctttcccgcatcgaggcgggcaagcttgtcata
gaagccatcccctgcgacatcaaggaactggtggacgaggtgttctccaccttcagcctc
gacgccacaggcaagggcatcacgctggagacgacaattgcccccggtacccccacctac
gttaggacagaccctctgcgcttgcggcagacgctgttcaaccttgtcggcaacgcggtc
aagttcacggagaagggtggcgtacgtgtggagttttccacagcctccatgcgcggcgac
gccatcgtcctgttctgtaccgtacgcgacaccggtcccggcatccccgaagacagaatc
gagagcatcttccagcccttcacccaactggacggctcctacacacgccgtcacagcgga
ctgggactcggccttggcatcgtatgcagactcatggaactcttcgggggcagcatcgaa
gtggagagcgcgccgaacatgggtacggccatgcatttcgccatcccggtcggaaagacc
cggcgcccgcagggcaggaaggtcaaggagacggaggatgaaggcgacaggcatgccctg
tacctgctcgtggcggaagacgatgccatcaatcgcctcaccctgacacggatgctggaa
cagctgggtcaccgcgcccatgccgtggaagacggcagtcaggccttgcaggctctcgcg
gagcagcatttcgatgccgtattcctcgacatccagatgcctgtcctcgatggcatggcc
accttgcaggccatccgtacgggacaggtcgcgggactgccccccaccattccggtcgtg
gccgtgaccgcacacgccatgcagggcgaccgagaacggttcatggcgaaaggggccgac
gcctatgtgcagaagccctacgacttcacagcactggagaaggcccttgcgaccctgggg
cggcgggtgcggcccgaaggccgcacccgtgaagactattcgttgtaa

DBGET integrated database retrieval system