KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0027Help
Entry
DvMF_0027         CDS       T00816                                 

Definition
(GenBank) indolepyruvate/phenylpyruvate decarboxylase
  KO
K04103  indolepyruvate decarboxylase [EC:4.1.1.74]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00380  Tryptophan metabolism
dvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DvMF_0027
Enzymes [BR:dvm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.74  indolepyruvate decarboxylase
     DvMF_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ACL06989
UniProt: B8DN45
Position
34593..36311
Genome map
AA seq 572 aa AA seqDB search
MNITEALLHALKERGAREVWGIPGDFALPYFKIIEQTGILPLVTLTHEPGLGFAADAAAR
IRRGLSVAAVTYGAGAINMLNAVAQAFAEKSPLVVVSGAPGTAERARGLLLHHQVKTVGS
QFRMYQEVTCDQGILDDPATAPAIIERVLRNCLEHSRPVYLEIPRDMPAVACGPVAPHMP
TPCDAEAVAACAAEVLARLRAASRPVLMVGVEVRRYGLEDRVAELADRLGVPVVTSFMGR
GLLAGKACLQGTYMGVAGDAAITQAVEGSDGLLLLGVIMSDTNFGVSASHIDRRRLMHAE
DRQVRMGFHTYHDIPLESLVDALLAALPEGGQACAVPAGLDGDGGALGRNVVYRRGFVAD
DAPVTPDDIAVLLNDFYDGVLNGPAVSAEPDPFPWPFGGRPLPWPLACDIGDCLFTALSV
RPVPMVGPGYYASMGFGVPAGMGLQVTTGQRSLTLVGDGAFQMTGMELGNCARLGIDPVV
VVFNNASWEMLRVFQPETSYSAINTLDFAAFADALGGHGYRVTTRRELAAAFASATTERG
RFQLIDVRLEKGAISDTLANFVAGVKRVSGVK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccgaagcgctgctgcacgccctgaaggaacgcggcgcgcgcgaggtctgg
ggcattcccggcgacttcgcgctgccgtatttcaagatcatcgagcagaccggcatcctg
ccgctggtcaccctgacgcatgagccggggctgggctttgccgccgacgccgccgcgcgc
attcgccgggggctcagcgtggccgccgtcacctacggggccggggccatcaacatgctg
aacgccgtggcccaggcctttgccgaaaagtcgccgctggtggtcgtttccggcgcgccg
ggcacggcggagagggcgcgcggccttctgctgcaccatcaggtgaagaccgtgggctcg
cagttccgcatgtaccaggaagtcacctgcgaccagggtattctggacgacccggccacc
gcccccgccatcatcgagcgggtgctgcgcaactgccttgagcattcgcgcccggtgtac
ctggaaattccgcgcgacatgcccgccgtggcctgcggcccggtggccccgcacatgccc
accccctgcgatgcagaggccgtggccgcctgcgcggcggaagtgttggctcggctgcgc
gccgccagccgtccggtactgatggtgggggtggaggtgcgccgctacggccttgaggac
cgcgtggcggaactggccgacaggctgggcgtgcccgtggtcaccagcttcatggggcgc
gggctgctggctggcaaggcctgcctgcaaggcacctacatgggcgtggcgggggatgcc
gccatcacccaggcagtggaaggctccgacggcctgttgctgctgggggtgatcatgtcc
gacaccaacttcggggtgtctgccagccacatcgaccgccgccgcctgatgcacgccgag
gaccgccaggtgcgcatgggcttccatacctatcacgacatcccgctggaaagtctggtg
gatgcgctgctggcagcccttcctgaaggcgggcaggcctgtgccgttccggcaggcctg
gacggcgatgggggggcgctgggccgcaacgtggtgtatcggcgcggtttcgtggcggac
gacgccccggtgacgcccgacgacatcgccgtgctgctcaacgatttctacgatggcgtg
ttgaacggaccggcggtcagcgccgagccggatccgttcccgtggccctttggcgggcgc
cccttgccgtggccgctggcctgcgacatcggcgactgcctgttcaccgcgctgtcggtg
cgccccgtgcccatggtggggccggggtactacgccagcatgggttttggcgtgcctgcg
ggcatgggcctgcaggtgaccaccgggcagcgttcgttgacactggtgggcgacggagcc
ttccagatgaccggcatggagcttggcaactgtgcgcgtctcggcatcgacccggtggtc
gtggtgttcaacaacgcctcgtgggagatgctgcgggtgttccagccggaaacctcgtac
agcgccatcaacacgctggacttcgccgcctttgccgatgcgctgggcgggcacggctac
cgcgtgaccacccggcgcgaactggcggctgcgtttgcctcggccaccacggagcgcggg
cgcttccaactcatcgacgtgcggttggaaaagggcgccatttccgacacactggccaat
ttcgtggccggggtgaagcgggtgtccggcgtgaagtag

DBGET integrated database retrieval system