KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0298Help
Entry
DvMF_0298         CDS       T00816                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00860  Porphyrin and chlorophyll metabolism
dvm01100  Metabolic pathways
dvm01110  Biosynthesis of secondary metabolites
dvm01120  Microbial metabolism in diverse environments
Module
dvm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DvMF_0298
Enzymes [BR:dvm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     DvMF_0298
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     DvMF_0298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M ThiF TrkA_N CysG_dimeriser
Motif
Other DBs
NCBI-ProteinID: ACL07255
UniProt: B8DPG8
Position
complement(343371..344057)
Genome map
AA seq 228 aa AA seqDB search
MRYYPLLLDLHGRACLVVGAGGVGRRKLASLLDCGPARVLVLDANPQAPDDPELAPLLAH
PAVRFEARPFAPADVDGCALVFAATGNRAVNAAVADACRQRNVPCNVADAPDTGAFIVPA
HFACGDLTVALSTGGHSPALARRIRMDLQQWFGARYDAITVLLGRLRPLVLALGQETRQN
TVLFRAIVESPIIDALAARDRAGAERILTELLPAELHPRIVELLHELA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcgttattatcccctgcttctcgacctgcacggacgcgcctgcctggtggtgggcgcg
gggggcgtggggcgccgcaagctggcgtcgctgctggattgcggcccggcccgcgtgctg
gtgctggacgccaacccgcaggctccggacgacccggaactggcccccctgctggcccac
cccgccgtgcgcttcgaggcgcggcccttcgcccccgccgacgtggacggctgcgcgctg
gtcttcgcggccacgggcaaccgcgccgtcaatgccgccgtggccgatgcctgccgccag
cgcaacgtgccctgcaacgtggctgacgccccggacacgggggcgttcatcgtgcccgcc
cacttcgcctgcggcgacctgacggtggccctttccaccggggggcacagcccggccctg
gcccggcgcatccgcatggacctgcagcagtggttcggcgcgcggtacgacgccattacc
gtactgttgggccgcctgcgcccgctcgtccttgcgcttgggcaagagacaaggcagaat
acggtgctgttccgcgccatcgtggaatcgccgatcatcgacgcactggccgcgcgcgac
cgcgccggggccgaacgcatcctgaccgaactgctgcccgcggaactgcatccgcgcatc
gtggagttgctgcatgagctcgcttga

DBGET integrated database retrieval system