KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1809Help
Entry
DvMF_1809         CDS       T00816                                 

Definition
(GenBank) Methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00670  One carbon pool by folate
dvm01100  Metabolic pathways
dvm01120  Microbial metabolism in diverse environments
dvm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DvMF_1809
Enzymes [BR:dvm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     DvMF_1809
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     DvMF_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACL08753
UniProt: B8DMA9
Position
complement(2210644..2211510)
Genome map
AA seq 288 aa AA seqDB search
MLLLDGKATAAAIRAELKEEVAAGLAAAGRAPGLAVILVGEDPASQVYVRNKERGCEEAG
IRSEAFRLPADTTQETLEVLIDELNGRADIDGILLQLPLPKGLNSQRCLERISPRKDVDG
FHPENMGRLALGLPGFRPCTPAGVMTLLERYDLSPSGKKAVVVGRSNIVGKPLALMLGAP
GKYANATVTVCHSGTPDLAEECRQADFLFVAAGRPCLVTSDMVKPGAVVVDVGIHRTDEG
LVGDCKYDDISCIAAAMTPVPGGVGPMTIAQLLINTVISWKGRTGIAG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctcgacggcaaggcgacggctgcggccattcgcgcggagctgaaggaagaa
gtggcggcggggcttgcggcggcgggccgcgcgccggggttggcggtcattctggtgggt
gaggatcccgcctcgcaggtgtacgtgcgcaacaaggagcgcggctgcgaagaggcgggc
atccggtccgaggcgtttcgcctgcctgcggacaccacgcaggaaacgctggaagtgctc
atcgacgaactgaacgggcgcgcggacatcgacggcatcctgctgcaactgccgctgccc
aaggggctgaacagccagcgctgtctggagcgcattagccccagaaaggacgtggacggc
tttcaccccgaaaacatgggacgtctggcgctggggctgccgggctttcgtccgtgcacc
ccggcgggggtgatgaccctgctggagcgttacgatctttcgccttcgggcaagaaggcc
gtggtggtggggcgcagcaacatcgtgggcaagccgctggcgctgatgctgggcgcgccc
ggcaagtacgccaacgccacggtgacggtgtgccattccggcacgccggacctggccgaa
gagtgccgccaggcggactttctgttcgtggcggcggggcggccctgcctggtcacctcg
gacatggtcaagcccggcgcggtggtggtggacgtgggcatccaccgtaccgacgaaggg
ctggtgggcgactgcaagtacgacgacatcagctgcatcgcggcggccatgaccccggtg
cccggcggcgtggggcccatgaccattgcccagctgctcatcaacaccgtgatctcgtgg
aagggccgcaccggcattgccgggtag

DBGET integrated database retrieval system