KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2146Help
Entry
DvMF_2146         CDS       T00816                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00250  Alanine, aspartate and glutamate metabolism
dvm00330  Arginine and proline metabolism
dvm01100  Metabolic pathways
dvm01110  Biosynthesis of secondary metabolites
dvm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DvMF_2146
   00330 Arginine and proline metabolism
    DvMF_2146
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dvm03000]
    DvMF_2146
Enzymes [BR:dvm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DvMF_2146
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     DvMF_2146
Transcription factors [BR:dvm03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    DvMF_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N
Motif
Other DBs
NCBI-ProteinID: ACL09089
UniProt: B8DQH0
Position
complement(2671182..2674223)
Genome map
AA seq 1013 aa AA seqDB search
MEQHLDARIVERGKEFFKSISGEAPSIFNKGFWTGKVMDWAMQNEGFKVQLFRFVDVLPY
LNTSEALTRHIREYFSADGADVPPVLKWGAGAAGFGGAFTGMLMGKFIRSNIEGMARTFI
IGENTKEAIKGLAKLRKEGFAFTVDLLGEATVSEEEADAYRDGYLEVLDAISREHAKWAP
LTDSTGSTTGPDASQDWGHTPKVNVSIKPSALYSQAKPGDVEGSVQGILSRLVPIYRKIV
EMGGFLCIDMEQLKYREMTLELFKRLRTMPEFRDYPHLSIVLQAYLRCTEHDLDELLAWG
RAERLPFGIRLVKGAYWDYETVMAKQNGWEIPVWTRKPESDICYEKLARRILENNDLVYF
ACASHNVRTISTVMETARALNVPAHRYEFQVLYGMAEPVRKGLKNVAGRVRLYCPYGELI
PGMAYLVRRLLENTANESFLRQSFVDGAELERLLENPQATLERELAAAPPPRSTPAAQPG
IDGLPPFVNESMLDLTIPANRAGFVNAIAEVRGKAGGVIPLFIGGKDVTTDDTIASTNPA
KPAEVIARVCQGGKPEVDAAIEAAQKAFPAWRDTSPADRAMFLHRAADIARRRMFELSAW
QVLEVGKQWDQAFHDVGEGIDFLDYYAHEMLRLGTPRRMGRAPGELNHLFYQPKGIAAVI
APWNFPFAIAIGMAAAAIVTGNPVIFKPSSIASRIGYNLTEIFREAGLPEGVFNYVPGRS
SVMGDYLVEHPQVSMICFTGSMEVGLRIQEKAAKVQPGQMQCKRVIAEMGGKNAIIIDDD
ADLDEAVLQVLYSAFGFQGQKCSACSRVIVLDPIYDRFVERLVKAAQAIKIGPSEDPANY
MGPVADASLQKNILEYVKVAEQEGKVLVKRTDIPAEGCYVPLTIVEGIKPHHRIAQEEIF
GPVLAVMRAGNFDEALAIANGTRFALTGGVFSRSPENLTKARREFRVGNLYLNRGSTGAM
VERQPFGGFKMSGVGSKTGGPDYLLQFMDPRCVTENTMRRGFAPIEEDDDWIG
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcatcttgatgcccgcatcgtcgagcgcggcaaggaattcttcaagagcatc
agcggcgaggccccgtccatcttcaacaagggcttctggaccggcaaggtcatggactgg
gccatgcagaacgagggcttcaaggtccagctgttccgcttcgtggacgtcctgccctac
ctgaacacctccgaggcgctcacccgccacatccgcgaatatttttccgccgacggagcg
gacgtgccccccgtgctcaagtggggcgcgggtgccgccggtttcggcggggccttcacc
ggcatgctcatgggcaagttcatccggtccaacatcgaaggcatggcccgcaccttcatc
atcggcgaaaacaccaaggaagccatcaaggggctggccaagctgcgcaaggaaggcttt
gccttcaccgtggacctgctgggcgaagccacggtgagcgaggaagaagccgacgcctac
cgcgacggctacctggaagtgctggacgccatctccagggaacacgcaaagtgggcgccg
ctgaccgattccacgggcagcaccaccggtcccgacgcctcgcaggactggggccacacc
cccaaggtgaacgtgtccatcaagccctccgccctctactcgcaggccaagcccggcgac
gtggaagggtccgtgcagggcatcctgtcgcgcctggtgcccatctaccgcaagatcgtg
gagatgggcggcttcctgtgcatcgacatggagcagctgaagtaccgcgaaatgacgctg
gaactgttcaagcggctgcgcaccatgcccgaattccgcgactacccgcacctgtccatc
gtgcttcaggcctacctgcgctgcaccgaacacgacctggacgagcttctggcctggggc
cgcgccgaaaggctgcccttcggcatccgcctggtgaagggcgcgtactgggactacgaa
acggtgatggccaagcagaacggctgggaaattcccgtgtggacccgcaagccggaatcg
gacatctgctacgaaaagctggcccgccgcattcttgaaaacaacgacctcgtctacttc
gcctgcgcctcgcacaacgtgcgcaccatttccacggtgatggaaacggcccgcgcgctg
aacgtgcccgcccaccgctacgaattccaggtgctgtacggcatggccgaaccggtgcga
aagggcctgaagaacgtggccgggcgcgtgcgcctgtactgcccgtacggcgaactgatc
cccggcatggcctaccttgtgcgccgcctgctggaaaacaccgccaacgaatccttcctg
cgccagagcttcgtggacggcgcggaactggaacggctgctggaaaacccgcaggccacg
ctggagcgcgaactggccgccgccccgccgccgcgttccactccggcggcccagcccggc
atcgacggcctgcccccgttcgtcaacgaaagcatgctggacctgaccatacccgccaac
cgcgcgggcttcgtgaacgccatcgcggaagtgcgcggcaaggcgggcggggtgattccg
ctgttcatcggcggcaaggacgtgaccaccgacgacaccatcgcctccaccaacccggcc
aaaccggcggaagtcatcgcccgggtctgccagggcggcaagccggaagtggacgccgcc
atcgaggccgcccaaaaggccttcccggcctggcgcgacacatccccggcggaccgggcc
atgttcctgcaccgcgcggcggacatcgcccgccgccgcatgttcgagctgtccgcctgg
caggtgctggaagtcggcaaacagtgggaccaggccttccatgacgtgggcgaaggcatc
gacttcctggactactacgcccacgaaatgctgcgcctcggcacgccgcgccgcatgggc
cgcgcccccggcgaactgaaccacctgttctaccagcccaagggcattgccgcggtcatc
gcgccgtggaacttccccttcgccatcgccatcggcatggccgccgccgccatcgtcacc
ggcaacccggtgatcttcaagccatcgtccattgcctcgcgcatcgggtacaaccttacg
gaaatcttccgcgaggcgggcctgcccgagggcgtgttcaactacgtgccgggccgcagc
tcggtcatgggcgattacctggtggaacacccgcaggtgagcatgatctgcttcaccggc
tccatggaagtgggcctgcgcattcaggaaaaggcggccaaggtgcagcccggccagatg
cagtgcaagcgggtcatcgcggaaatgggcggcaagaacgccatcatcatcgacgacgac
gccgacctcgacgaggccgtgctgcaggtgctgtattccgcgttcggcttccaggggcag
aagtgctcggcctgctcgcgggtcatcgtgctggatcccatctacgaccgcttcgtggag
cggctggtgaaggcggcgcaggccatcaagatcggcccgtcggaagacccggccaactac
atgggcccggtggccgacgcatcgctacaaaagaacattctggaatacgtgaaggtggcc
gagcaggaaggcaaggtgctggtgaagcgcaccgacatccccgcagagggctgctacgtg
ccgctgaccatcgtggaaggcatcaagccgcaccaccgcatcgcgcaggaggaaatcttc
ggcccggtgctggccgtgatgcgcgcggggaactttgacgaggcgctggccatcgccaac
ggcacccgctttgccctgaccggcggcgtgttctcgcgcagccccgaaaacctgaccaag
gcccgccgcgaattccgcgtgggcaacctgtacctgaaccgcggctccaccggggccatg
gtggaacgccagcccttcggcgggttcaagatgtcgggcgtcggctccaagaccggcggc
cccgactacctgctgcagttcatggacccgcgctgcgtgaccgaaaacaccatgcgccgg
ggctttgcgcccatcgaggaagacgacgactggatcgggtag

DBGET integrated database retrieval system