KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_3185Help
Entry
DvMF_3185         CDS       T00816                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Brite
KEGG Orthology (KO) [BR:dvm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DvMF_3185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACL10121
UniProt: B8DNH9
Position
complement(4016345..4017355)
Genome map
AA seq 336 aa AA seqDB search
MLEIPVLLVVIVIVALIFDFTNGAHDCANAIATVVSTKVLSPRTAVAMAAVLNLFGAMLG
EEVAHTLGQGIVNTNMVAGSQTLVLAALIGAIAWNLITWYYGLPSSSSHALIGGLMGAAI
THAGFSTLNAMSIVKKILLPLVLSPLAGFAVSYACMMLLMLLFWRTNRRTVTRSFEKLQI
VSSAFMATSHGLNDAQKTMGVITLALFLFHQIDTIHVPLWVKLSCALAMAMGTALGGWKI
VKTMGHKIFKLEPVHGFAAETSAAVVITGASLMGAPISTTHTITACVFGVGATKRLSAVR
WGIAGNLVVAWILTIPAAATMASISFLILELLGIAD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagataccggtgctgctcgtcgtcatcgtcatcgtcgcgctgatcttcgacttc
accaacggggcgcacgactgcgccaacgccatcgccaccgtggtctccaccaaggtgctt
tccccgcgcaccgccgtggccatggccgccgtgctgaaccttttcggcgccatgctgggc
gaagaggtggcgcacaccctgggccagggcatcgtgaacaccaacatggtcgcgggcagc
cagaccctggtgctggccgcgctcatcggggccatcgcctggaacctgatcacctggtac
tacggcctgccttcctcgtcgtcgcacgcgctcatcggggggctgatgggggctgccatc
acccacgcggggttcagcacgctgaacgccatgtccatcgtcaagaagatactgctgccg
ctggtgctctcgcccctggcgggctttgccgtcagctacgcgtgcatgatgctgctgatg
ctgctgttctggcgcaccaaccggcgcacggtgacgcggtcgttcgaaaaattgcagatc
gtctcctccgcgttcatggccaccagccatggcctcaacgacgcgcagaagaccatgggc
gtcatcactctggccctgttcctgttccaccagatcgacaccatccacgtgccgttgtgg
gtcaagctgtcctgcgccctggccatggccatgggcaccgcccttggcgggtggaagatc
gtgaagaccatggggcacaagatattcaagctggagccggtgcacggcttcgcggcggaa
acgtccgccgccgtggtcatcaccggggcttcgctgatgggcgcgcccatttccaccacc
cacaccatcaccgcctgcgtgttcggcgtgggggccaccaaacgcctgtccgccgtgcgc
tggggcattgcgggcaacttggtagtggcgtggattctcaccattcccgccgccgccacc
atggcgtccatcagcttcctgattctggaactgctaggcatcgccgactag

DBGET integrated database retrieval system