KEGG   Desulfovibrio vulgaris Hildenborough: DVU0168Help
Entry
DVU0168           CDS       T00171                                 

Definition
(RefSeq) oligopeptide/dipeptide ABC transporter permease
  KO
K02033  peptide/nickel transport system permease protein
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu02024  Quorum sensing
Module
dvu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DVU0168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dvu02000]
    DVU0168
Transporters [BR:dvu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    DVU0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 2793574
NCBI-ProteinID: YP_009393
UniProt: Q72FP5
Position
complement(208285..209262)
Genome map
AA seq 325 aa AA seqDB search
MFAFIIRRVAQALLVMFIISLLGFAIKYSFGDPTREMMGVSVSVKEREALREELGLNDPF
AVQWTRFASGALKGDLGISYFYRKPALDVILDKAPATLELVFVAACLIILISVPVGVYAA
CRPKDVLSRLFMGVSTIGVSVPVFLTAIFLIYIFSVNLGWLPSFGRGNPEHVIGSWDTNL
TTWANFKHIILPGISLSSIMLPLFIRLIRAEMKEVLETEYVKFARAKGLKTWRVIMVHAF
KNTLLPVITVGGVQLGTMIAFTILTETVFQWQGMGFMFIDAVERADTSLLVAYLIFCGAI
FVTVNTVVDIVYGLVNPMVRIAGRK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcattcatcatacgcagggttgcccaggcgctccttgtcatgttcatcatcagc
ctgctcgggttcgccatcaagtattcgttcggcgaccccacgcgtgagatgatgggcgtt
tcggtatctgtgaaggagcgcgaggccctgcgcgaagagcttggcctcaacgacccgttc
gccgtccagtggacccgcttcgcctcgggcgccctcaagggcgacctcggcatctcgtat
ttctaccgcaagcccgccctcgacgtcatactcgacaaggcacctgccaccctcgaactg
gtgttcgtggcggcatgcctcatcatcctcatctccgtacccgtgggcgtctatgcggcg
tgccgccccaaggacgtgctttcacgtctgttcatgggcgtaagcaccatcggtgtgtcg
gtgccggtcttcctcaccgccatattcctcatctacatcttctcggtgaacctcggctgg
ctgccctctttcgggcgcggcaaccctgagcacgtcatcggctcatgggacacgaacctc
accacgtgggccaatttcaagcacatcatcctgcccggcatctcgctctcctccatcatg
ctgccgctcttcatccgcctcatccgcgccgagatgaaggaagtgctcgagaccgagtac
gtcaaattcgcccgcgccaagggccttaagacatggcgcgtcatcatggttcacgccttc
aagaacacgctgctgccggtcatcaccgtcggcggggtgcagcttggcaccatgatcgcc
ttcaccatcctcaccgagacggtcttccagtggcagggcatgggcttcatgttcatcgac
gccgtggaacgcgccgacacctcgctgcttgtggcgtacctcatcttctgcggcgccatc
ttcgtgacggtgaacaccgtggtcgacatcgtctacggtctggtgaaccccatggtccgc
atcgcggggaggaaatag

DBGET integrated database retrieval system