KEGG   Desulfovibrio vulgaris Hildenborough: DVU0701Help
Entry
DVU0701           CDS       T00171                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00620  Pyruvate metabolism
dvu00630  Glyoxylate and dicarboxylate metabolism
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01120  Microbial metabolism in diverse environments
dvu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DVU0701 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    DVU0701 (glcB)
Enzymes [BR:dvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DVU0701 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 2795485
NCBI-ProteinID: YP_009922
UniProt: Q72E78
Position
778761..780950
Genome map
AA seq 729 aa AA seqDB search
MTGRIREGGLAVAEPLHRCIEREILPGTGISPSIFWAGLEELVGTLGPRNRELLARRDNM
QAAIDAWHKEHQGRPHDAAAYRRFLEDIRYLLPAPQDLAVETQGVDPEVATIAGPQLVVP
VTNPRYALNAVNARWGSLYDALYGSDVIADSDGAARGAAYNPLRGAKVVAYAAAFLDRTF
PLAGARHADVVRYELTGPPVGRKLSALCADGTVTGLLHPDAFAGYTGGERPTTVLLRNNG
LHVELQFDRRHPVGAAHPAGLKDVVLESAVTTILDCEDSVATVDAEDKALAYRNLLGLFR
GDLETSFDKGGRSVFRRLAADRTYTAPGGAAYALPGRSLMLVRNVGLLMTTDAVLDAAGQ
EIPEGILDGLVTACIGLHDLRGAGRHRNSGAGSVYIVKPKLHGPEEVAFVCEQFRRIEDI
LGMARNTLKMGVMDEERRTTLNLAECIRVASQRIIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAQRWMLAYEDWNVDTGLAAGFGGKAQIGKGMWPKPDRLAEMVATKGAHPRAGANC
AWVPSPTAATLHALHYHEVDVFARQRELAGCHRASLDDLLALPLMGEARPSPAEVREELE
NNAQSILGYVVRWVEMGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGICTEDEVR
DVMLRMATVVDRQNKDEPGYRPMSADPGSSVAFRAACDLVFEGARQPNGYTEPILHARRR
EVKARSLTR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcatacgtgaaggcggcctcgctgtggccgaacccctgcaccgttgtatc
gaacgcgagattctgccgggcaccggcatctccccctccatcttctgggcggggctggaa
gagcttgtcggcaccctcggcccccgtaaccgcgaattgctggcccgacgggacaacatg
caggcggcgatagacgcatggcacaaggagcatcaggggcggccgcacgatgccgcagcc
tacaggcgttttctcgaagacatccgttatctgcttcccgcaccgcaggacctcgcggtt
gaaacgcagggggtcgaccccgaagtggcgaccatcgccgggccgcaacttgtcgtgccc
gtgaccaacccccgctatgccctcaatgccgtcaacgcccgctggggcagcctctacgac
gccctgtacggcagcgacgtgattgccgacagcgacggggctgcacgtggcgctgcctac
aatcccctgcggggcgcgaaggtggtggcgtatgccgccgcgttcctcgacaggacattc
ccgttggccggggcgaggcatgccgacgtggtgcgctacgagttgaccgggccaccggtg
ggtcgcaagctgtcggccctctgtgccgacggtacggtgacgggcctgctgcatcctgat
gcgttcgccggctatacggggggagagcgcccgacgacggtgctgctgcgcaacaacggg
ctgcatgtcgaattgcagttcgaccgcaggcacccggtgggggctgcccaccctgcggga
ctcaaggatgtggtgctcgagtcggcggtgaccaccatcctcgattgcgaggattccgtg
gccaccgtcgatgccgaagacaaggccctcgcctatcgcaacctgcttggactgttccgg
ggcgaccttgagacctcgttcgacaagggcgggcgcagcgtcttcaggcgtctggcagca
gacaggacgtacaccgcaccgggcggggcagcgtatgccctgccggggcgcagcctgatg
ctggtgcgtaacgtggggctgctcatgaccaccgacgccgtgctcgacgcggcagggcag
gagattcctgaaggcatcctagacgggctcgtcaccgcctgcatcgggctgcacgacctg
cgcggtgcggggcgtcatcgcaacagcggagccggcagcgtgtacatcgtcaaacccaag
ctgcatggccccgaagaggtggcgttcgtctgcgagcagttcagacgcatcgaagacatc
ctcggcatggcgcgcaataccctcaagatgggggtgatggacgaggaacggcgaaccacg
ctcaatcttgcggagtgcatacgggtggcttcgcagcgtatcatcttcatcaatactggc
ttcctcgaccgtacgggcgacgagatacacacctgcatggaggcggggcccgtcgtgcgc
aagaacgacatgaaggcccagcgctggatgctcgcctatgaggactggaacgtggacacc
gggcttgccgccggtttcggcggaaaggcccagataggcaagggcatgtggcccaagccc
gacaggctggcggagatggtcgccaccaagggggcgcacccgcgtgccggggccaactgc
gcgtgggttccctctccaacggcggcgacgctgcacgccctgcactaccatgaggtggat
gtcttcgcgcgtcagcgcgaacttgccggatgtcaccgggcgtcgctggacgaccttttg
gcattgccgctcatgggtgaggcgcgtccctcgcccgctgaagtgcgcgaagaactggag
aacaacgcccagagcatcctcggctacgtggtacggtgggtcgagatggggataggctgc
tcgaaagtgcccgatatccatgacgtgggtctcatggaagacagggccaccctgcgtatc
tccagccagcacatcgccaactggttgcgccatggcatctgcacggaggacgaggtgcgt
gacgtcatgctacggatggcgaccgtggtcgacaggcagaacaaggatgaaccgggctac
cggcccatgtctgccgaccccggttccagcgtggcgttcagggcggcatgcgacctcgtg
ttcgagggggcgcgccagcccaacgggtataccgaacccatcctccatgcccgcaggcgc
gaggtgaaggcgcgtagtctcacccggtag

DBGET integrated database retrieval system