KEGG   Desulfovibrio vulgaris Hildenborough: DVU0895Help
Entry
DVU0895           CDS       T00171                                 

Definition
(RefSeq) recombinase D
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DVU0895
Enzymes [BR:dvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DVU0895
DNA repair and recombination proteins [BR:dvu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DVU0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD PIF1 T2SSE AAA_28 ArgK AAA_29 AAA NTPase_1 RsgA_GTPase UvrD-helicase TrwB_AAD_bind AAA_16 HHH_2 ABC_tran AAA_22 PhoH Zeta_toxin AAA_23 cobW NB-ARC AAA_24 DUF2075 HHH_6 MMR_HSR1 HHH_3 TsaE CbiA MobB
Motif
Other DBs
NCBI-GeneID: 2794113
NCBI-ProteinID: YP_010116
UniProt: Q72DN4
Position
986193..988421
Genome map
AA seq 742 aa AA seqDB search
MQTGKTATTEEQTAEALEELEGTLERVIFHNAENGYTVFRFQPKGKGGDAVSVVGHMVDP
QPGVGLLLRGGWVNNPKFGRQFRMETFESVLPATVEGIRHYLGSGLIKGVGETMAARIVA
RFGESTFSVLDDAPDRLIEVEGVGAKTLERIKTSWAEHRGIRDLIMFLQPHGVSTAYAVR
IYRYYGTHALTVVRENPYRLAMDIHGIGFITADGVATKLGFSKDSPLRAEAGVLYMLGRL
TEDGHVYFPFDGLVTHTGDKLDIRYDLVEDAIHSLEREERVVLEDLGEGVGVFLTRFHHY
ETKIAYYLRRVLASPKAVHFENPDAVVDKVLGKLDIALAPEQLEAVRTSTRSKVMVLTGG
PGTGKTTIINAIIRVFAEVGARILLAAPTGRAAKRMSETSGRESRTIHRLLEFSPKEDGF
ARNEDNPLACGLLVVDEASMMDTMLMYHLLKAVPLGATLLFVGDVHQLPSVGPGNVLRDV
IVSGVVPVVELREVFRQAAESEIICNAHRINQGEVPPLESSRDRLSDFYFIRQSDPAKVV
EMILELVRDHIPRRFGLHPVDDIQVLTPMHKGLAGAGNLNLRLQEALNPQTLCVQRGERQ
FRLDDKVMQIRNNYEKDVYNGDIGRICCVNAKERELTVRYDERNVIYAWEELDEIVPAYA
ISVHKSQGSEYPAVVIPVLTQHYVLLQRNLIYTGVTRGKRLVVLVGESRALAMAVKNNRM
QKRHTWLAHRLAQGLSTPGALL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccggaaagaccgccaccacggaagagcagaccgccgaagcccttgaagaactg
gagggcaccctcgagcgcgtcatcttccacaatgccgagaacggctacacggtgttccgc
ttccagcccaagggcaagggaggcgatgccgtcagcgtggtggggcacatggtcgacccg
caacccggcgtgggcttgctgctgcgtggcgggtgggtgaacaaccccaagttcggtcgt
cagttccgcatggagaccttcgagagtgttctgcccgccaccgtagagggcatccgccac
tatctcgggtcggggctgatcaagggggtgggcgagaccatggccgcgcgcatcgtcgcc
cggttcggcgagtcgaccttcagcgtgctggacgatgcgcccgaccgcctcatcgaggtc
gaaggcgtgggggccaagacgctggaacgcatcaagaccagctgggccgagcaccggggc
atccgcgacctcatcatgttcctgcaaccgcatggcgtgagcaccgcctatgccgtccgc
atctacaggtactacggcacgcatgcgctcaccgtggtacgcgagaatccgtatcgcctc
gccatggacatccacggcatcggcttcatcaccgccgacggggtggccaccaaactcggt
ttttccaaggacagccccctgcgcgccgaggcgggggtgctgtacatgctaggtcgtctg
acggaagacgggcatgtctactttcccttcgacggactggtgacgcatacgggtgataaa
ctcgacatccgttacgaccttgtcgaggacgccatccactcgcttgagcgagaggagagg
gtcgtgctcgaagaccttggcgaaggcgtaggggtcttcctcacccgtttccaccactac
gagacgaagatagcctactacctgcggcgcgtactggcttcgcccaaggccgtgcacttc
gagaatcccgacgccgtggtggacaaggtactgggcaagctcgacatcgcccttgcgccg
gaacagcttgaggcggtgcgcaccagcacccgcagcaaggtcatggtgctcaccgggggg
ccgggtacgggcaagaccaccatcatcaacgccatcatccgcgtcttcgccgaggtgggg
gcacgcatcctgcttgccgcgcccaccggacgcgccgccaagcgcatgtccgagacaagc
gggcgcgagtcgcgcaccatccaccgcctgctggagttcagccccaaagaggatggcttc
gcccgtaacgaggacaaccccctcgcctgcgggctgctggtggtggacgaagcctcgatg
atggacaccatgctcatgtaccacctgctgaaggccgtgccgctaggggcgacgctgctc
ttcgtgggtgatgtgcaccagttgccgtcggtggggccgggcaacgtgctgcgcgatgtc
atcgtctccggcgtggtgccggtggtggaattgcgcgaggtgttccgtcaggccgccgag
agcgagatcatctgcaacgcccaccgcatcaatcagggcgaggtgccgcctctcgaatca
tcgcgcgacaggctttccgacttctatttcatccggcagtccgaccccgccaaggtcgtg
gagatgatcctcgaactggtgcgcgaccacatcccccgtcgcttcgggctgcatcccgtc
gatgacatccaggtgctcacgcccatgcacaaggggcttgcgggtgcgggcaacctcaac
ctgcgcctgcaggaggccctcaacccccagaccctctgcgtgcagcggggcgagcgtcag
ttccgtctcgacgacaaggtcatgcagatacgcaacaactacgagaaggatgtctataac
ggcgacatcgggcgtatctgctgcgtcaacgccaaggagcgcgagctcaccgtccgctac
gatgaacgcaatgtcatctatgcgtgggaagagcttgacgagattgtgcccgcgtacgcc
atctcggtacacaagtcgcaggggtcggagtatcctgctgtggtcattccggtgctcacg
cagcattacgtccttctgcaacgcaatctcatctacaccggggtcacgcggggcaaacgg
cttgtggtgctcgtcggcgaatcgcgtgcgcttgccatggcggtgaagaacaaccggatg
cagaagcgtcatacatggctggcgcacaggctggcgcaggggctttccacccccggcgcg
ctcctctga

DBGET integrated database retrieval system