KEGG   Desulfovibrio vulgaris Hildenborough: DVU0926Help
Entry
DVU0926           CDS       T00171                                 

Definition
(RefSeq) hypothetical protein
Organism
dvu  Desulfovibrio vulgaris Hildenborough
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 2794626
NCBI-ProteinID: YP_010147
UniProt: Q72DK3
Position
complement(1017547..1017738)
Genome map
AA seq 63 aa AA seqDB search
MASPIFTTHCRTCRLQDNHLTRFTKKRSGGDVEGAHPRTRLQRATRLPPPTCRNARHSQA
SIA
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagccctatcttcaccacgcactgccgcacctgccgactccaagacaaccatctg
acaagattcacgaagaaacgcagcggcggcgatgtggaaggggctcatccccggacacgc
ctccagcgcgcgacccgcttgcccccccctacctgtcgcaacgcacgacattcccaagca
tccatagcatag

DBGET integrated database retrieval system