KEGG   Desulfovibrio vulgaris Hildenborough: DVU1197Help
Entry
DVU1197           CDS       T00171                                 

Gene name
nusB
Definition
(RefSeq) N utilization substance protein B
  KO
K03625  N utilization substance protein B
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dvu03021]
    DVU1197 (nusB)
   03009 Ribosome biogenesis [BR:dvu03009]
    DVU1197 (nusB)
Transcription machinery [BR:dvu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     DVU1197 (nusB)
Ribosome biogenesis [BR:dvu03009]
 Prokaryotic Type
  rRNA transcription factors
   DVU1197 (nusB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusB
Motif
Other DBs
NCBI-GeneID: 2796654
NCBI-ProteinID: YP_010416
UniProt: Q72CT6
Position
complement(1289617..1290078)
Genome map
AA seq 153 aa AA seqDB search
MTTKGTPSRRAARALAFQILYGLGFSPAASVKQLREAYASSPDVADKGRSPQPEGFAWEL
IEGIWTEQANIDEVIGLFSQNWRIDRIGRVELTLLRIAVYEMLYRIDVPPKVAINEALEL
SKQFGDANARGFINGILDAAAKALEGGQLKPRV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaaaggcaccccttcccgccgggccgcgcgggcacttgccttccagatactc
tacgggctcggtttctcgcctgccgcttcggtgaagcagttgcgcgaagcctatgcctcg
tcgcccgacgtggccgacaaggggcgctcgccgcagccggagggcttcgcgtgggaactc
atcgagggtatctggactgaacaggcgaacatcgacgaggtcatcggcctcttctcgcag
aattggcgcatcgaccgcatcggaagggtcgaactcacgctcctgcgcatcgccgtgtac
gaaatgctctaccgcatcgacgtcccgcccaaggtcgccatcaacgaggcccttgagcta
tcgaagcaattcggagacgccaacgcacgcggtttcatcaacggcatcctcgatgccgca
gccaaggccctcgaaggcgggcagctcaaaccccgcgtctga

DBGET integrated database retrieval system