KEGG   Desulfovibrio vulgaris Hildenborough: DVU1308Help
Entry
DVU1308           CDS       T00171                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DVU1308 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dvu03011]
    DVU1308 (rplV)
Ribosome [BR:dvu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DVU1308 (rplV)
  Bacteria
    DVU1308 (rplV)
  Archaea
    DVU1308 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 2794191
NCBI-ProteinID: YP_010527
UniProt: Q72CH5
Position
1396271..1396609
Genome map
AA seq 112 aa AA seqDB search
MESRATAKFMRVSPRKTRLVARNIDGLPVEDAMNLLRFTPNKPAGVLYDVLRSALANAQQ
MPGVDVDAMVVKQVVVNEGPSWKRFLPRAQGRATRIKKRTSHITVILAEGQE
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagagcaactgcgaaattcatgcgcgtttctccgcgcaagacccgactggtc
gcccgtaacatcgacgggctgcccgtcgaggatgcgatgaacctcctgcggttcaccccc
aataagccggccggtgtgctttacgacgtgctgcgttcagcgcttgccaatgcccagcag
atgcccggcgttgacgtggacgccatggtcgtcaagcaggtcgtcgtgaacgaaggcccc
agctggaagcgttttctgccccgtgcacagggccgcgctactcgcatcaagaagcgcacc
agccatatcaccgtgattctcgcagaaggtcaggaatag

DBGET integrated database retrieval system