KEGG   Desulfovibrio vulgaris Hildenborough: DVU1463Help
Entry
DVU1463           CDS       T00171                                 

Definition
(RefSeq) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00860  Porphyrin and chlorophyll metabolism
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01120  Microbial metabolism in diverse environments
Module
dvu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DVU1463
Enzymes [BR:dvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     DVU1463
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     DVU1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M ThiF Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 2794881
NCBI-ProteinID: YP_010682
UniProt: Q72C21
Position
complement(1542188..1542865)
Genome map
AA seq 225 aa AA seqDB search
MRPYPLFMRLDGCRCLVVGAGGVGRRKLAALIPCGAAEILVLDTSPPDAELAALLACPGV
RFEQRTFSADDLAGRSLVFAATGVPAANADIARLCRDGGVLCNVIDDPAAGSFIVPAHFA
CGDITVALSTGGHSPALARRIRMDLEAWFGNRYDGLVVLMGRLRPLVLALGDETGQNAAL
FRTIVGSPLVDALAAKDRQRCEDLLHTLLPVELHPHIVELLHDIA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccctatcccctcttcatgcggcttgatggttgccgatgcctcgtcgtcggcgca
ggcggcgtgggacgccgcaaactggcggcactcatcccctgcggcgccgccgagatactc
gtcctcgatacgtcgccgcccgatgccgaactggcagccctgctcgcctgccccggcgtc
cgcttcgaacagcgcaccttctcggccgacgaccttgcaggccgttcgctggtgttcgcc
gccacaggtgtgcccgcagccaatgccgacatcgcccgcctctgccgcgatggcggcgta
ctctgcaacgtcatcgacgaccccgcagccggttcgttcatcgtcccggcgcacttcgcc
tgtggcgacatcaccgtcgccctgtccacgggggggcacagccctgcgctggcacgccgc
atccgcatggaccttgaagcatggttcggcaaccgttacgacggacttgtggtgttgatg
ggcagacttcggccactcgtccttgcactcggcgacgagacagggcagaatgcggccctc
tttcgcaccatcgtaggctcaccgcttgtggacgccctcgccgcgaaggacaggcagcgg
tgtgaagaccttctccacaccctgcttcccgtcgaactgcacccgcacatcgtggagttg
ctgcatgatatcgcctga

DBGET integrated database retrieval system