KEGG   Desulfovibrio vulgaris Hildenborough: DVU1677Help
Entry
DVU1677           CDS       T00171                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00010  Glycolysis / Gluconeogenesis
dvu00051  Fructose and mannose metabolism
dvu00562  Inositol phosphate metabolism
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01120  Microbial metabolism in diverse environments
dvu01130  Biosynthesis of antibiotics
dvu01200  Carbon metabolism
dvu01230  Biosynthesis of amino acids
Module
dvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU1677 (tpiA)
   00051 Fructose and mannose metabolism
    DVU1677 (tpiA)
   00562 Inositol phosphate metabolism
    DVU1677 (tpiA)
Enzymes [BR:dvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DVU1677 (tpiA)
Exosome [BR:dvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DVU1677 (tpiA)
  Exosomal proteins of bladder cancer cells
   DVU1677 (tpiA)
  Exosomal proteins of melanoma cells
   DVU1677 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2794905
NCBI-ProteinID: YP_010895
UniProt: Q72BF9
Position
complement(1756281..1757036)
Genome map
AA seq 251 aa AA seqDB search
MKKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVLVCPPFTALHALHDTFKDVEG
FAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLK
AGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGKV
AGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL
QAVSFSRIILA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcatcgccgccaattggaaaatgtacaagaccatcgacgaggctagggct
acgggacgcgaacttgtgtccgccgtcgccgggtcactgcccgcagaccgtgaggtgctc
gtgtgcccccccttcacggcgctccatgcccttcatgacaccttcaaggacgtcgagggg
tttgccatcggcgggcaggatgtctacccggctaccgaaggggcctacaccggcgaaatc
gcacccggcatgttgctcgatgccggatgcggatgggtgctcaccgggcactctgaacgg
cgtcatattctcggtgaggacgacgagacggtcgcgcgcaagacggctttcagcctgaag
gccggactgcgtgtggtactgtgcatcggcgaaaagcttgatgaacgtgaggctggcagg
cttgaagacgtgctggcgcatcagctgcaggtcgggcttgcagatgtcgacgcgacctat
gtaccccagtcgcttgtggtggcctacgaacccgtatgggctatcggtacgggcaaggtg
gcggggcctgccgaagtcgtcgaggctcacgctcttgtccgttcgctactcgaagcccgt
tacggtcgcgacggtgccgccatacgcatcctgtacgggggcagcgtgaagcctgacaac
gccgcagaactactttctcttgacaatgtcgacggtctgctggtaggaggcgcttctttg
caggctgtcagcttcagccgcatcattctggcatga

DBGET integrated database retrieval system