KEGG   Desulfovibrio vulgaris Hildenborough: DVU1977Help
Entry
DVU1977           CDS       T00171                                 

Gene name
groES
Definition
(RefSeq) co-chaperonin GroES
  KO
K04078  chaperonin GroES
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dvu03110]
    DVU1977 (groES)
   03029 Mitochondrial biogenesis [BR:dvu03029]
    DVU1977 (groES)
Chaperones and folding catalysts [BR:dvu03110]
 Heat shock proteins
  HSP10
   DVU1977 (groES)
Mitochondrial biogenesis [BR:dvu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    DVU1977 (groES)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10 PhyH
Motif
Other DBs
NCBI-GeneID: 2795991
NCBI-ProteinID: YP_011194
UniProt: Q72AL5
Position
complement(2052641..2052928)
Genome map
AA seq 95 aa AA seqDB search
MNLKPLNDRVLVKRLESEEKTAGGLYIPDTAKEKPSRGEVVAAGPGKTADDGKLVAMTVK
AGDMVLFNKYAGTEIKIDGVEHLVMREDDILAIIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgaagcccctcaacgaccgcgttctcgtcaagcgcctcgagtccgaagaaaag
actgctggcggcctctacatccccgacaccgcgaaggaaaagccctcgcgcggtgaagtc
gtggctgccggccccggcaagaccgccgatgacggcaagctcgtcgccatgacggtgaag
gctggcgacatggtgctgttcaacaagtacgccggtaccgaaatcaagatcgacggcgtc
gagcatctggtcatgcgcgaagacgacatcctcgccatcatcgagtaa

DBGET integrated database retrieval system