KEGG   Desulfovibrio vulgaris Hildenborough: DVU2322Help
Entry
DVU2322           CDS       T00171                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00040  Pentose and glucuronate interconversions
dvu00052  Galactose metabolism
dvu00500  Starch and sucrose metabolism
dvu00520  Amino sugar and nucleotide sugar metabolism
dvu01100  Metabolic pathways
dvu01130  Biosynthesis of antibiotics
Module
dvu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DVU2322
   00052 Galactose metabolism
    DVU2322
   00500 Starch and sucrose metabolism
    DVU2322
   00520 Amino sugar and nucleotide sugar metabolism
    DVU2322
Enzymes [BR:dvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DVU2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 2795282
NCBI-ProteinID: YP_011535
UniProt: Q729M8
Position
2417314..2418753
Genome map
AA seq 479 aa AA seqDB search
MESSAPMSPRPEHATHSARESFSRLMREERLPGELIDLFLGYHGEIEASHTGLIGENDIL
PAKVEDFTHLDSLTRYAPEGRKLMHRAVCIRLNGGLGTSMGMTHAKSLLPARHDRSFLDI
IHGQAEHQRKAHGGASPLLFMNSYATHADTLRALESMAAPEHMPRCFLQHRFPKVDRATL
LPVRSHEAGDMAWNPPGHGDIYAALVLSGMLDALLSEGRRWALVANADNLGASLDPAILG
YMAAHRIPFLMECARRTPADSKGGHLARTPEGGLVLREVAQCPADDMAHFQDIHRYGLFN
TNNIWLDLAALRDRVERYGLLRLPLILNPKTLDPRDPESTPVWQVETAMGAAIALFPGAT
AIVTPRRRFLPVKRCNDLLLLWSDCFSLGEDFHLNRRVAHDSPLPRIDLDPKHYGTWDRL
MQRFPHGAPAMRSCTAMQVRGDVRFGDDVALDGEVRIRNSAKAQAVIPDGTRLSGEVHL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagcgcccccatgtcacctcgccccgaacatgcgacacattccgcgcgcgag
tcgttcagtcgcctcatgcgtgaagagaggctgccgggcgaactcatcgacctcttcctc
ggctatcatggcgaaatcgaggccagccataccggactcatcggtgagaatgacatcctg
cccgccaaggtcgaggatttcacccatctcgacagcctgacccgctatgcccccgaaggc
cgcaagctgatgcaccgcgccgtctgcatcaggctcaatggtggtctcggcaccagcatg
ggcatgacacacgccaagtcgcttctgccagcacgacacgacaggagttttctcgacatc
atccacggacaggcagaacatcagcgcaaggcccacggcggcgcatcgcccctgctgttc
atgaacagctacgccacgcacgccgacaccctgcgtgccctcgaaagcatggcggccccc
gaacacatgccgcgttgcttcctgcagcatcgtttccccaaggtcgaccgcgccacactc
cttcccgtacgaagccatgaagccggcgacatggcgtggaaccctccggggcacggcgac
atctacgccgccctcgtactctcgggcatgctcgacgccctgctttccgaaggtcgccga
tgggcgctggttgccaacgccgacaatctaggggcatcactcgacccggccattctcggc
tacatggcggcacatcgcatcccctttctcatggaatgcgcccgtcgcacccccgccgac
agcaagggcgggcaccttgcccgcacaccggaaggcggtctcgtcctgcgcgaggtggca
cagtgccctgccgacgacatggcccactttcaggacatccatcgctacggactcttcaat
accaacaacatatggctcgacctcgcggcactgcgtgacagggttgaacgctacggcctg
ttgcggttgcccctcatcctcaatcccaagacgctcgacccccgcgaccccgaatccact
cccgtctggcaggtggaaacggccatgggggcggccatcgccctctttccgggtgcgaca
gccatcgtcaccccccgccgccgctttctgccggtcaaacgctgcaacgacctgctgcta
ctctggtcggactgcttcagcctcggcgaggacttccacctcaatcgccgcgtggcgcat
gacagccccctgccccgcatcgacctcgaccccaagcattacggcacatgggacaggctc
atgcagcgctttccgcacggcgcccccgccatgcgcagctgcaccgccatgcaggtgcgc
ggagacgtccgcttcggcgatgacgtagccctcgacggagaagtccgcatccgtaacagt
gcaaaggcacaggctgtcatccccgacggcacgcgtctgtctggcgaagtgcacttgtag

DBGET integrated database retrieval system