KEGG   Desulfovibrio vulgaris Hildenborough: DVU2746Help
Entry
DVU2746           CDS       T00171                                 

Definition
(RefSeq) hypothetical protein
Organism
dvu  Desulfovibrio vulgaris Hildenborough
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-GeneID: 2794019
NCBI-ProteinID: YP_011958
UniProt: Q727V8
Position
2851089..2852033
Genome map
AA seq 314 aa AA seqDB search
MLAIPFHKMSPGGNTTILVPHSAVDALHRAPVATRLMHGLHLGAEQVGFIDMGSSIPRLD
MMGGEFCGNACRCLAALLLLEGRVQDDGQGGSTGRIAASGVSTPVHFTARHLPDGAVDAS
IRMDLPAMPDMVDIAPGMSLVRLPGISHLLLDLALHPYPGRPGETVPGILRRYGLDEAPA
AGCIWFGENGGRRFIKPVVHVRDTATIHEETACGSGTLALALHLSRHAAPAADAIDKAAS
PATGKPAERITRVPRDCCTPPDDAECTNDAWHVIGQPSGAVIRATVKAGADGIEAWIGGP
VTLIAQGKAFVSIA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttagccatcccattccacaaaatgagtcccggcggaaacaccaccatcctcgtcccc
cactccgctgtagatgcccttcacagggcccctgtcgccacgcggctcatgcacggcctc
caccttggggcggaacaggtgggcttcatcgacatggggtcttccatcccccgcctcgac
atgatgggaggcgaattctgcggcaatgcctgccgctgccttgccgcactcctcctgctt
gaaggacgggtgcaggacgacggacaaggagggagcacagggcgcatcgccgcctccggc
gtatcgactccggtacacttcacagcaaggcacctgcctgacggtgcagtggacgcctcc
atacgcatggaccttcccgccatgccagacatggtcgacatcgcaccgggcatgagcctt
gtccgccttcccggcatcagccacctgttgctcgaccttgcgcttcacccctaccccgga
cgccccggtgagacagtgccaggcatcctgcggcgctacggactggatgaggcacccgct
gcggggtgcatctggttcggtgaaaacggcggaaggcggttcatcaagccggtagtgcat
gtccgggacaccgccaccatccatgaagagacggcgtgcgggtcggggacgctggcgctg
gcattgcacctctcgcgccacgccgcccctgcggctgatgccatcgacaaggccgcaagc
cccgcaacgggcaagccagccgaacgcatcacccgcgtaccccgtgattgctgcactcct
ccggatgatgcggagtgcacgaacgacgcgtggcacgtcatcggacaaccaagcggtgcc
gtcatccgtgccacagtgaaggcgggtgccgacggcatcgaggcatggattggcgggcct
gtgaccctcatcgcccaaggcaaggctttcgtttccatcgcctga

DBGET integrated database retrieval system