KEGG   Desulfovibrio vulgaris Hildenborough: DVU2885Help
Entry
DVU2885           CDS       T00171                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00010  Glycolysis / Gluconeogenesis
dvu00071  Fatty acid degradation
dvu00350  Tyrosine metabolism
dvu00625  Chloroalkane and chloroalkene degradation
dvu00626  Naphthalene degradation
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01120  Microbial metabolism in diverse environments
dvu01130  Biosynthesis of antibiotics
dvu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU2885
  Lipid metabolism
   00071 Fatty acid degradation
    DVU2885
  Amino acid metabolism
   00350 Tyrosine metabolism
    DVU2885
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DVU2885
   00626 Naphthalene degradation
    DVU2885
Enzymes [BR:dvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DVU2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 2793915
NCBI-ProteinID: YP_012097
UniProt: Q727H0
Position
2982927..2984120
Genome map
AA seq 397 aa AA seqDB search
MLDFTFHVPTRIVFGAGRLEELGRLPLPGVKPLVVVGAGGSMRRHGHLDRVLALLRQNGC
EPMLFERVRPNPSLVHVDEGACVARANGCDFIVGLGGGSPIDAAKAIALAAANGGSYWDY
IQSGTGGRRTPQHPALPVVAIPTTAGTGTEADPWTVVTRDETQEKIGWGNDSTYPVLSIV
DPALTITVPPRITAMTGMDAFFHAVEAYLSLSRQPSSDLLALEAVSLLAQFLPQAVRQGD
SVEVRSMVSWASTAAGLCESLSSCIAHHSMEHALSAYHPDLPHGAGLVMLSLPFFEVMAR
VQPKRCADLAATMGMPLHGLPPAQQGMAFVEGLRLLIRAVGLDDLRLADHGITAAEIPAL
AKNARETMGALFPLTPVDLRPEDVEAIFAKALAGPTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacttcaccttccatgtccccacccgtatcgtgttcggtgcaggcaggctcgaa
gaactgggcaggctgccgctgcccggcgtcaagcctctggtggtcgtcggtgcaggtggt
tccatgcggcgtcacgggcacctggacagggtgctcgccctgctgcgccagaacggctgc
gaaccgatgctcttcgagcgcgtcagacccaatccctcgctggtgcacgtggacgaaggg
gcgtgcgtggcacgcgccaacggctgtgacttcatcgtcggcctcggcggcggcagcccc
atcgacgcggccaaggccatcgcccttgccgcagccaacggtggcagctactgggactac
atccagagtggcacaggcggccgccgcaccccgcagcaccctgcgctgcccgtcgtcgcc
attccgaccacggcgggcacgggcaccgaagccgacccgtggacggtggtgacccgtgac
gagacacaggagaaaatcggctggggcaacgactcgacctacccggtgctgtccatcgtc
gaccccgcgcttaccatcaccgtcccgccccgcatcaccgccatgacaggcatggatgcc
ttcttccacgccgtggaagcatatctttccctctcgcgccagccctcaagcgacctgctg
gcactggaggccgtgagcctgctggcgcaattcctgccacaggccgtccgtcagggcgac
agcgtcgaggtgcgttcgatggtctcgtgggccagcaccgccgctgggctgtgcgaatcg
ctctcttcctgcatcgcgcaccattcgatggaacacgccctcagcgcctaccaccccgac
ctgccgcacggcgcgggcctcgtgatgctctcgctgccgttcttcgaggtcatggcgcgg
gtgcaacccaagcgttgcgccgacctcgccgccaccatggggatgccgttgcatgggctg
cctccggcacagcagggcatggccttcgtcgaagggctacggttgctcatccgcgccgtg
ggcctcgatgacctgcgccttgccgaccatggcatcaccgccgcagagattcccgcgctg
gcgaagaacgcccgcgagaccatgggggcgctctttcccctgacgccggtggacttgcgc
cccgaagacgtcgaagccatcttcgccaaggccctcgcgggcccgacggcctga

DBGET integrated database retrieval system