KEGG   Desulfovibrio vulgaris Hildenborough: DVU3073Help
Entry
DVU3073           CDS       T00171                                 

Definition
(RefSeq) hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Brite
KEGG Orthology (KO) [BR:dvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dvu03009]
    DVU3073
Enzymes [BR:dvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     DVU3073
Ribosome biogenesis [BR:dvu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DVU3073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ
Motif
Other DBs
NCBI-GeneID: 2796424
NCBI-ProteinID: YP_012284
UniProt: Q726N3
Position
3216311..3217222
Genome map
AA seq 303 aa AA seqDB search
MPQYTVYLAPAGYEQDLIDELGPRVIDVRGRLVRASGGPRHAAWAQNIWLDPVEMRIGSI
GDAATRLKGIQRNWFLHAVDHHRRAALIAGKLPHVSARPHVFGTPAPTAPLGSWTLWEHD
LVIASARCSSPFPDGEVHFVENRIDPPTRAYLKLWETFTRLGVQPAPGELCLDMGSCPGG
WTWVLAGLGARVFSVDKADIAPHIAAMPNVNFCTGSAFGLDPQHAGAVDWFFSDVICYPD
RLLATVQRWLERGQCRNFVCTLKFQATTDHATAAAFAAIPGSQLFHLAHNKHELTWVLLR
DKA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtacaccgtctatctcgcccccgcaggctacgaacaggacctcatcgacgaa
ctgggcccgcgtgtcatcgacgtgcggggcaggctcgtacgggcctcgggcggcccgcgc
cacgcagcgtgggcgcagaacatctggctcgacccggtggagatgcgcataggttccatc
ggcgatgcggcgacacggctcaagggcatccagcgcaactggttcctgcacgccgtcgac
caccaccgccgcgccgccctcatcgccgggaagctgccgcatgtgagtgccagaccccat
gtcttcggcacaccggcccccaccgccccgctgggttcgtggacgttgtgggagcatgac
cttgtcatcgcctcggcgcggtgttcatcgcccttccccgacggcgaggtgcacttcgtg
gagaaccgcatcgacccgcccacccgcgcctacctcaaactgtgggagaccttcaccaga
ctcggcgtacagcccgcccccggtgagctgtgcctcgacatgggcagttgtcccggcggg
tggacatgggttctcgccggacttggggcgcgcgtcttcagcgtcgacaaggcggacatc
gcaccgcacatcgccgccatgcccaacgtgaacttctgcaccggcagcgcgttcggtctc
gacccgcagcacgccggggccgtggactggttcttctccgacgtcatctgctaccccgac
aggcttctcgccaccgtgcaacgctggctcgagcgcgggcaatgccgcaacttcgtctgc
acgctcaagttccaggcgaccaccgaccacgccaccgcagcggccttcgccgccataccg
gggtcgcaactcttccaccttgcccacaacaagcacgaactgacatgggtgctcctgcgc
gacaaggcgtga

DBGET integrated database retrieval system