KEGG   Drosophila willistoni: 6641312Help
Entry
6641312           CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein LOC6641312
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dwi  Drosophila willistoni
Pathway
dwi00260  Glycine, serine and threonine metabolism
dwi01100  Metabolic pathways
dwi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    6641312
Enzymes [BR:dwi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     6641312
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 6641312
NCBI-ProteinID: XP_002064036
FlyBase: FBgn0221948
UniProt: B4MSD3
Position
Unknown
AA seq 140 aa AA seqDB search
MGGERWAAAGFVALEQIVPLLGKDHERTKRIAKAVHDLSSPNVVVDLDAVQTNILFLEIK
QPDLVGSEFVQDLENVQPDELRAGVKDKNGLGVVVRSCDLTLKSVRLVLYHQIDDEQVKL
AIKKLTFVIKQYDARWPKVQ
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggggggtgaaagatgggcagctgctggctttgtggcattggaacagattgtaccttta
ctgggaaaggatcatgagagaactaagcgcattgccaaggccgttcatgatctaagtagt
cccaatgtggttgtcgatttggatgctgtgcaaaccaacatcctttttttggagataaaa
caacccgatttggtgggcagtgagtttgttcaggatttggaaaacgttcagcccgatgaa
ttgagagccggtgtcaaggataagaatggtctgggagttgtagtcagatcgtgtgacctt
accttaaagtcagttcgtttagttctttatcatcaaatcgatgatgaacaggtcaaattg
gccattaaaaagctgacttttgtcatcaagcaatatgatgcacgatggccaaaagtgcaa
taa

DBGET integrated database retrieval system