KEGG   Drosophila willistoni: 6643345Help
Entry
6643345           CDS       T01067                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dwi  Drosophila willistoni
Pathway
dwi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6643345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dwi03041]
    6643345
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     6643345
Spliceosome [BR:dwi03041]
 Complex C
  Other components
   Step II factors
    6643345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 T2SSE AAA_19 AAA_30 Flavi_DEAD AAA
Motif
Other DBs
NCBI-GeneID: 6643345
NCBI-ProteinID: XP_002066074
FlyBase: FBgn0224153
UniProt: B4MY71
Position
Unknown
AA seq 1250 aa AA seqDB search
MDELQQLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRSYEAFRKALADNGAEFP
DSLVQNLQRIINLMRPSRPKDDKIPAGSTGKDDKKSELMKMFPGLALPNDTYSKTENEDH
KEDRKDEKQKPDKKDRKESKPKISEMSDVDAAMLELEALAPGENKAKESSTKRRERSRSR
NRDRDRRKRSKSRGNRDGHRSKSRERDRSRRNSRRSRSREDGHGERDRRRSRDREHRARD
DRRRRSRSREDRDRRRRSRSREERRHRSRSRDRREKMPPPTAVMADDPEAGKIYSGKVAN
IVDFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVSRNQTVKVKVMSITGQKVSLS
MKEVDQESGRDLNPLSHAPEDEDISLRDRNPDGPFSSSTSMLNLQGNNLDGDEHESRKRV
TRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGH
GRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEMEALPTNLNKNWIDP
LPEEDSGRHLAANMRGMGLAPQEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPIYKLR
DDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVA
EEYGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLMEAELKGYSVIMLDEAHERT
IHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKE
PETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILP
VYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGM
DSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQ
LKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSK
MLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNS
WKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGF
FRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPK
WLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattgcagcagctggagtatctatcgctggtctccaaaatttgtacagagttg
gacaaccatttgggcatcaatgacaaggatttggctgaatttattattgacttggagaac
aagaatcgcagctatgaagcgttccgcaaggctttggcagacaatggagctgagtttcca
gactctttggttcagaatttacagcgtatcattaatcttatgcgtcctagccgtcctaaa
gacgataaaattcctgctggttcaacgggaaaggatgacaaaaaatcggaacttatgaag
atgtttccgggtttagcattacccaatgatacgtacagcaaaactgaaaacgaagaccat
aaagaggacagaaaagatgaaaagcaaaaaccggacaagaaggatcgcaaggagagcaaa
ccaaaaatttccgaaatgagcgatgtggatgctgcgatgttggaactggaggcattggct
ccgggagagaataaagcaaaagaatcatccacaaagcgcagagagcgtagtcgtagtcgc
aatagagatcgggatcgacgaaagcgtagtaagtctcgcggaaatcgagatggccatcgg
agcaagtctcgcgaacgcgatcggtcacgccgtaacagcagacgaagcagatcacgtgaa
gatggccatggagaacgagatcgtcgtaggagtagagacagagaacaccgcgctcgtgat
gatcgtcgtaggcgaagcagatctcgagaggatcgagatcgccgcagaaggagcaggtcc
cgagaagaacgacgccatagatcgcggtcccgggaccgacgagaaaaaatgccaccacca
accgccgttatggctgatgacccagaagctgggaaaatctactccggtaaggtggccaat
attgttgactttggttgttttgtgcagctttttggcctgcgtaagcgctgggagggttta
gttcacatatctcagctgagagcggagggacgtgtaaccgatgtgacggaggtagtaagc
cgtaatcagacggtcaaggttaaggtgatgtccatcactggtcaaaaggtatccctctcg
atgaaagaagtcgatcaagagtccggccgagacttaaaccctctctcgcatgctccagag
gatgaagacatatcgttgagggatcgcaatccggatggtccgtttagcagcagcacctcc
atgctaaatctgcagggaaataatctcgacggtgatgagcatgagtcaagaaaacgtgta
accagaatatccagtcccgaacggtgggagattaagcagatgatcagctctggagtgctt
gatcgcagcgaaatgccagattttgatgaggaaactggtttgcttcccaaggacgaggac
gatgaggccgatatagaaattgagattgttgaagaagagccacccttcctctcaggccat
ggacgagccctccacgatctatccccagtgaggattgtgaagaatcccgatggatctctc
gcgcaagcagcaatgatgcaatcggctctttccaaagagcggcgtgaacagaaaatgttg
cagcgcgaacaagaaatggaagcgttgcccaccaatctcaacaaaaactggatcgatcct
ttgccagaggaggactctggtcgtcatttagcggcaaatatgcggggcatgggactagct
ccccaagaagtgcccgaatggaagaagcatgtaattggaggaaaaaaatcatccttcggc
aaaaagacggacttaacgcttgttgagcagcgacaatctctgcccatctacaagctacgc
gatgatctcatcaaggcggtgacagacaatcaaattctgattgttatcggggagactgga
tccggtaaaactacccaaatcacccaatatctaggtgaatgcggatttacggcacgtgga
aagattggatgcacacaaccgcgtcgtgtggctgccatgtcggtggcaaaacgtgtggcc
gaggaatatggttgccgtcttggtcaagaagtgggctataccatacgtttcgaggattgc
accagtccggagactgtaatcaagtacatgacagacggcatgttgctccgcgaatgcctt
atggaggctgaacttaagggctattcagtcatcatgttggatgaggctcacgaacgaaca
attcacactgatgttctgtttggtctgctgaagacggccgtgcaaaaacgcccggaattg
aaactaattgttacctcagccactttggatgcggtcaagttttcgcagtatttctttgaa
gctcccatttttacaattcctggacgtacatttcccgtggaggtgttgtatacaaaggag
ccggagaccgactatttagatgcctctctaattacggtgatgcaaatacatttgcgtgaa
ccgcccggtgatattttgcttttcctcactggtcaggaggagattgacacggcctgcgag
atattatacgagcgcatgaagagtctaggccccgatgtgcccgaactgatcattttgcct
gtctattctgctctgccatccgagatgcaaacacgcatctttgaccctgctccggcaggc
agtcgtaaggtggtaatcgccacgaatatcgctgagacttcactaaccatagatggtata
ttttatgtggtggatccaggatttgttaaacagaaagtctacaactcgaagacgggcatg
gattcgcttgtagttactcccatttcgcaggcagcagccaagcaaagagctggcagggca
ggacgtactgggccaggaaaaacctatcgtctttacacggagcgagcttatcgggatgag
atgttgccgacgcccgtgcccgaaatccaacgtaccaatctggcaaccacagtgcttcaa
cttaagaccatgggtatcaatgatctgctgcactttgatttcatggatgcaccaccagtg
gagtctttggttatggccttggaacagctgcattcactctcggctcttgatgatgagggc
ttacttacccgtttgggtcgtcgcatggccgaatttccacttgagccgaatctctccaaa
atgcttatcatgtcggtagccctgcagtgttctgatgagattttgacaattgtgtccatg
ttgagtgtgcaaaatgtgttttacaggccaaaagataaacaggcgttggccgatcagaaa
aaggcaaaatttaatcaagctgagggtgatcacttaaccctgttggcagtctacaacagt
tggaagaataacaaattctcgaatgcttggtgttatgaaaattttgttcagatacggaca
ttaaaacgttcacaggatgtacggaaacaactgcttggtattatggatcgtcataaattg
gatgtggtatcggcgggcaagaattctgtgcgcattcaaaaggcaatttgttctggcttc
tttcgtaatgctgcaaaaaaggatccacaggaaggttatcgtactctggttgattctcag
gtggtttacattcatccttcaagtgctctgttcaatagacagcccgaatgggtcatctat
catgaactggtgcagaccaccaaagagtatatgcgcgaggtgaccacaattgatccaaaa
tggttggtggaattcgctccatccttcttccgcttctctgatccaaccaaactgagtaaa
tttaagaaaaatcaacgacttgagccattgtacaacaaatatgaagagcctaatgcttgg
agaatatcccgagttaggcgcagacggaattaa

DBGET integrated database retrieval system