KEGG   Drosophila willistoni: 6643404Help
Entry
6643404           CDS       T01067                                 

Definition
(RefSeq) activin receptor type-1 isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
dwi  Drosophila willistoni
Pathway
dwi04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    6643404
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dwi01001]
    6643404
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     6643404
Protein kinases [BR:dwi01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   6643404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6643404
NCBI-ProteinID: XP_002066176
FlyBase: FBgn0224205
UniProt: B4MYH3
Position
Unknown
AA seq 573 aa AA seqDB search
MESSNIKLFFLLCFLMKINVKAEISGRLLEENQDIADTDMELNGAGAVKEFPAVPQNSVQ
LHARFKCYACEAPCLNPYEHAHTCQNAIQCWKSTTRDAEGQVTVSRGCSTSPDHLPLICS
QSSRSKHNSASPAKRNTANFVNVECCTGDFCNSGEFPELPPFMGNDVTVITADSSNMSKM
ALAILGPFLVITLMGAVAIFFMRRSHRKRLAASRIKQDPESYLVNDELLRATSAGDSTLR
EYLQHSVTSGSGSGLPLLVQRTLAKQVTLLECIGRGKYGEVWRGHWHGESIAVKIFFSRD
EESWKRETEIYSTVLLRHENILGFIGSDMTSRNSCTQLWLMTHYYPLGSLFDHLNRNPLS
HNDMICICLSIANGLVHLHTEIFGTEGKPAMAHRDLKSKNILVTSNGTCVIADFGLAVTH
SHVTGQLDMGNNPKVGTKRYMAPEVLDESIDLECFEALRRTDIYAFGLVLWEVCRRTISC
GIAEEYKVPFYDVVPMDPSFEDMRKVVCIDNYRPSIPNRWSSDSLLAGMSKLMKECWHQN
PNVRLPALRIKKTIHKLAATDEKIRLDFDEVCV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcgaacattaaattattttttctattgtgtttcttaatgaaaataaatgta
aaagctgagatcagtggtcgacttctagaagagaatcaagatatagccgatacggatatg
gaactaaatggtgcaggagcagttaaagaatttccagctgtaccacaaaactcagtacaa
ttacatgccagatttaaatgctatgcttgcgaggcaccttgcctaaatccctatgagcat
gcccacacctgtcagaatgccattcagtgctggaaatcaacaacacgcgatgctgaggga
caggtgactgtttcgcgtggttgttccacctcaccggatcacttgccgctgatttgtagc
caaagttctcgaagtaaacacaactcagcatcgccagcaaaacggaatacggcgaatttc
gtaaatgtcgaatgctgtacgggagatttttgcaatagcggtgaatttccggaattgcca
ccattcatgggtaacgatgtgaccgtcataactgctgatagcagtaatatgagtaaaatg
gccttggccatattgggtccattcttggtcattacgttaatgggagctgtggccatattc
tttatgcgtcgcagtcatcgcaaacgtttggccgcttcccgcattaaacaagatccggaa
tcctatttggttaacgatgagctgctccgagccaccagtgctggggatagcacactgagg
gaatatttacagcattccgtcacctcgggatcaggcagtggcctgccattgctggtgcaa
cgcactttggccaaacaggtgacccttctcgagtgcattggtcgtggcaaatatggtgaa
gtgtggcgtggtcattggcatggcgaaagcatagccgttaagatctttttcagccgtgac
gaagagtcctggaagcgtgagacggagatttatagcactgttctgttgcggcatgagaat
attttgggtttcattggctccgatatgacatcaaggaattcctgcactcagctctggcta
atgactcactactatccattgggctcactttttgatcatctaaatcgcaatcccctaagc
cacaacgatatgatctgtatttgtttatctatagccaatggcttggtacatctgcatacc
gaaatctttggcactgaaggcaaaccggcaatggcccatcgtgatctgaaatcaaagaat
atattggtaacctctaatggtacatgtgtcattgccgattttggtctagctgtaacccat
tcccatgtcactggacaattggatatgggtaataatcccaaagtgggcacaaaacgctac
atggcccccgaagtgctcgatgagagcattgatttggaatgctttgaggccttgcgccgc
acagatatctatgcgtttggtttggtcctctgggaggtgtgccgccgcaccatttcttgc
ggcattgccgaggagtataaagttcccttctatgatgtggtgccgatggatccaagtttt
gaggatatgcgtaaagttgtttgcatagacaactatagaccctcaatacccaatcgctgg
agttccgattcgctcctggctggcatgtccaagttaatgaaggaatgctggcatcagaat
cccaatgttcgtttgcccgccttgcgcattaaaaagactatacacaaattagctgccacg
gatgagaaaatacgtttagatttcgatgaggtctgcgtttag

DBGET integrated database retrieval system