KEGG   Drosophila willistoni: 6644711Help
Entry
6644711           CDS       T01067                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dwi  Drosophila willistoni
Pathway
dwi00020  Citrate cycle (TCA cycle)
dwi00640  Propanoate metabolism
dwi01100  Metabolic pathways
dwi01200  Carbon metabolism
Module
dwi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dwi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6644711
   00640 Propanoate metabolism
    6644711
Enzymes [BR:dwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     6644711
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     6644711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 6644711
NCBI-ProteinID: XP_002067317
FlyBase: FBgn0218247
UniProt: B4N1R4
Position
Unknown
AA seq 351 aa AA seqDB search
MSSLINWRRGLLQAPNHLAQWLAMRHQADYAKTIANLKIKKETKVMIQGFTGKQGTFHAK
AAQEYGTNIVGGVSPSKGGTTHLDKPVFKTVKEAVKELKPDATAIFIPPNNAGEGICAAI
ENEIGLIVAITEGIPQVDMVRIMQMLNCQEKSRLLGPNCPGIISPEQCKIGIMPSHIHKR
GTVGIVSRSGTLTYEAVLQTTSVGLGQSLCIGCGGDPFNGTSFIDGLKIFLADPETKGII
LIGEIGGSAEEDAADYLKEHNSGCNAKPVVSFIAGQSAPPGRRMGHAGAIISGGKGAAKD
KVAALEKAGVIVAKNPCHMGQLLHNEMVRLKIIPKPNDPKSTNGKTNKTEK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccttgatcaattggcgtcgtggactcctgcaggctcccaatcatctggcccag
tggctagcgatgcgacatcaggccgactatgcgaaaaccattgccaatctaaagatcaag
aaggagaccaaagtgatgatacagggtttcacgggcaaacagggtacattccatgccaag
gccgcccaggaatacggaaccaatatcgtgggtggcgtgtcgccttccaagggtggaaca
acgcatttggataagcccgttttcaagacagtcaaggaggccgtcaaggagctgaaaccc
gatgccactgccatctttataccgcccaacaatgctggcgaaggcatctgtgcggccatc
gagaatgagattggcctaattgtggccatcacggagggcataccacaggttgatatggta
cggattatgcagatgttgaactgccaggagaaatcacggctgctggggcccaattgtccg
gggattatatcgcccgaacaatgcaaaatcggtatcatgccatcgcatatacacaaacgc
ggcacggtgggcattgtttcccgctccggcaccctcacctacgaggccgtgcttcagaca
acaagtgtcggcctcggtcaatcgctgtgcatcggctgtggcggcgatcccttcaatggc
accagtttcatagatggcctcaagatctttctcgccgatccagagaccaagggcattata
ctaattggtgaaattggcggatccgccgaagaagatgccgcggactatctaaaggagcat
aattctggttgcaatgccaagcctgttgtgtccttcattgccgggcaatcggctccacca
gggcgacgaatgggtcatgccggagccattatatcgggcggcaagggtgctgccaaggat
aaagtcgctgccctggagaaggctggtgtcattgtggccaagaatccctgtcacatgggt
cagttacttcacaatgaaatggttcgcttgaagatcatcccaaaaccgaatgaccccaaa
tcaaccaacggcaagaccaacaaaactgaaaagtag

DBGET integrated database retrieval system