KEGG   Drosophila willistoni: 6646154Help
Entry
6646154           CDS       T01067                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
dwi  Drosophila willistoni
Pathway
dwi00051  Fructose and mannose metabolism
dwi00520  Amino sugar and nucleotide sugar metabolism
dwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    6646154
   00520 Amino sugar and nucleotide sugar metabolism
    6646154
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     6646154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 6646154
NCBI-ProteinID: XP_002068779
FlyBase: FBgn0219959
UniProt: B4N5X6
Position
Unknown
AA seq 434 aa AA seqDB search
MLKAVILIGGPQKGTRFRPLSLDTPKPLFPLAGRPLIAHHIEACVQLKELREILIIGYYP
QTQMEGFVSDMQSLYSSSNINIRYLQEFTSLGTAGGMYHFRDQIRAGNPRAFFVLNGDVC
ADFPLQELYDFHTQRPPSALVTIMSTEATRQQSLHYGCLVFDRGSGAVSHYVEKPSSYVS
TFINCGVYVCSMDIFTILAQIFHARGQEYNCVGFCNGNGRDQGHIKWEQEVLTPLAGTDK
LFAMPVPNWWSQLKTAGSAIYANRHYLGLYKKTHPERLANVGTKRGEGDGSLICTVYPDV
YVHPSASVHHSAVLGPNVAIGPGVTIGPGVRIRESIVLEQAQIKDHTLILHSIVGRGSTI
GAWARVEGTPSDPDANKPFAKMENPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLP
HKELSRSFKNEIIL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggctgtaatccttattgggggaccacagaaagggacacgatttcgtcccctc
tccctggacacgcccaaaccgttatttcctcttgccggtcgtcctttgattgcccaccac
attgaggcatgtgttcaattgaaggaattgagggaaatccttataataggatattatcca
caaacgcaaatggagggatttgtaagcgatatgcagagcttatatagcagcagcaacatc
aacatcagataccttcaggaattcacttcgttggggactgctggaggcatgtaccacttt
cgtgatcaaatacgggccggcaatccgcgcgccttcttcgtgctcaatggcgatgtgtgt
gccgattttccacttcaggagctctatgattttcacacacagcgcccgcccagtgctttg
gtgaccattatgagtacggaggcgacacgtcaacagtccttgcactacggctgtctcgtt
ttcgatcgcggaagtggcgccgtctctcactacgtggagaaaccgagttcatatgtctcc
acattcatcaattgcggcgtctatgtatgctccatggatatattcaccatactagcccag
atattccatgctcgtgggcaggagtataactgtgttggtttctgcaatggcaatggcagg
gatcagggtcacatcaagtgggaacaagaagtacttacacctctggctggtacggataaa
cttttcgccatgcctgtacccaattggtggtcacaattgaagacagccggctcggcgatt
tatgcaaatcgtcattatttgggtttgtacaagaagacgcatccggaacgacttgctaac
gttggtactaaacgcggcgaaggcgatggaagtctaatctgcacagtctatcctgacgtc
tatgtgcatcccagtgcctcagtccatcattcagctgtgcttggtcccaacgtcgccatt
ggtcctggcgttaccattggccctggtgttcgcattcgcgaatcaattgttctcgaacaa
gctcagataaaggatcacactttaatacttcattcaatagttggtcgtggctccactatc
ggcgcttgggcaagagttgagggcacgcccagtgatccagatgcaaataaaccatttgcc
aaaatggaaaatccgccacttttcaacaatgaaggcaaactaaatccgtctataaccata
ttgggttgttttgtccaagtgccagctgagaagatccttttaaatagtattgtcctgccg
cacaaagaacttagccgcagcttcaaaaatgaaatcatcttgtaa

DBGET integrated database retrieval system