KEGG   Drosophila willistoni: 6646233Help
Entry
6646233           CDS       T01067                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 3
  KO
K12734  peptidyl-prolyl cis-trans isomerase-like 3 [EC:5.2.1.8]
Organism
dwi  Drosophila willistoni
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dwi03041]
    6646233
   03110 Chaperones and folding catalysts [BR:dwi03110]
    6646233
Enzymes [BR:dwi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     6646233
Spliceosome [BR:dwi03041]
 Complex C
  Other components
   PPlases
    6646233
Chaperones and folding catalysts [BR:dwi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    6646233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 6646233
NCBI-ProteinID: XP_023033639
Position
Unknown
AA seq 161 aa AA seqDB search
MSVTLHTDVGDLKIELFCEACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTG
KNGQSIWGTKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGR
VIDGFDALDELEKLPVNPKNYRPHVDKKINGVTIHANPLAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaacgttacacaccgatgttggcgatctaaagatcgaactgttctgcgaggcg
tgtcccaaggcttgtgaaaatttccttgccttatgtgctagcgactattacagcggctgc
gtcttcatcaggaatattaagggatttattgtacaaactggtgatcctaccaataccggc
aagaatggtcaatctatatggggcaccaaattcgatgatgagttcaaagagactattaag
cacacagatcgtggaatggtgtcaatggccaacaatggacccaatgcaaatgccagccaa
ttctttataacatatgccgcccaacccaatttagatttaaaatatacgcttttcggccgt
gttatagatggtttcgatgctttggatgagctggaaaagctgccagttaatcccaaaaac
tatcgtccacatgtggacaagaaaatcaatggagtcactatacatgccaatcccttagcc
gcatga

DBGET integrated database retrieval system