KEGG   Drosophila willistoni: 6647329Help
Entry
6647329           CDS       T01067                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dwi  Drosophila willistoni
Pathway
dwi03040  Spliceosome
dwi04141  Protein processing in endoplasmic reticulum
dwi04144  Endocytosis
dwi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6647329
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6647329
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6647329
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6647329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dwi01009]
    6647329
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dwi03041]
    6647329
   03009 Ribosome biogenesis [BR:dwi03009]
    6647329
   03110 Chaperones and folding catalysts [BR:dwi03110]
    6647329
   04131 Membrane trafficking [BR:dwi04131]
    6647329
   03051 Proteasome [BR:dwi03051]
    6647329
   03029 Mitochondrial biogenesis [BR:dwi03029]
    6647329
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    6647329
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     6647329
Spliceosome [BR:dwi03041]
 Complex B
  Other components
   Prp19 complex
    6647329
 Complex C
   Prp19-CDC5 complex
    6647329
Ribosome biogenesis [BR:dwi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    6647329
Chaperones and folding catalysts [BR:dwi03110]
 Heat shock proteins
  HSP70 / DNAK
   6647329
Membrane trafficking [BR:dwi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    6647329
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    6647329
Proteasome [BR:dwi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    6647329
Mitochondrial biogenesis [BR:dwi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    6647329
Exosome [BR:dwi04147]
 Exosomal proteins
  Proteins found in most exosomes
   6647329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF4824
Motif
Other DBs
NCBI-GeneID: 6647329
NCBI-ProteinID: XP_023034288
FlyBase: FBgn0213020
Position
Unknown
AA seq 650 aa AA seqDB search
MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTQTIFDAKRLIGRKFEDSAVQSDMKHWPFEVVSVDGKPKIEVVYKDEKKTFFPEEIS
SMVLTKMKETAEAYLGKTVANAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTH
FVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRA
RFEELNADLFRSTMDPVEKALRDAKLDKSAIHDIVLVGGSTRIPKVQRLLQDLFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKN
GLESYCFNMKATLDEENLKTKISDSDRTTILDKCNDTIKWLDANQLADKEEYEHRQKELE
GVCNPIITKLYQSAGGAPGGMPGAPPGAAGPGAAPGAGAGGAGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagcacctgctgttggtattgatttgggaaccacctactcttgcgtgggtgtc
ttccagcatggcaaggttgaaattattgccaacgatcagggtaatcgtaccacaccatcg
tatgttgccttcacggatacggagcgtttgattggtgatgccgccaaaaatcaggtggcc
atgaacccaactcaaactatcttcgatgctaagcgtttgattggtcgcaaatttgaggat
tccgctgtgcagtcggacatgaagcactggcccttcgaggtcgtcagtgtagatggcaag
cccaagattgaagttgtctacaaggatgagaagaagaccttcttccccgaggagatctcc
tccatggtgttgaccaaaatgaaggagaccgccgaggcctacttgggcaagacagtggcc
aatgctgtcatcactgtccccgcttacttcaacgattcgcagcgtcaggcgaccaaggat
gctggtaccattgccggattgaatgtattgcgtattatcaatgagcccacagcggctgct
attgcctacggcttggacaagaaggctgttggtgagcgcaatgtcttgattttcgatctg
ggcggtggtactttcgatgtgtccattctgtcgatcgatgacggcatcttcgaggtcaaa
tcgacggctggtgatacccatttgggtggtgaggatttcgacaaccgtctagtcactcac
ttcgtgcaggagttcaagcgtaagcacaagaaggatctgaccaccaacaagcgtgccctt
cgtcgtctgcgcaccgcttgcgagcgcgcaaagcgtaccctgtccagctccacccaggcc
agcattgagattgattctctgttcgagggtaccgatttctacacctcgatcacccgtgcc
cgtttcgaggagttgaacgctgatctgttccgcagcaccatggaccccgtggagaaggct
ctccgtgatgccaagttggacaagtcggccattcacgatattgtgttggtcggtggttcc
acccgtatccccaaggtgcagcgtctgctccaggatctgttcaatggcaaggagctgaac
aagtccatcaatcccgatgaggctgtggcctacggcgctgccgtccaggctgccatcttg
cacggtgacaagtcccaggaagtgcaggatctgctgttgctcgatgttaccccattgtcc
ctgggtattgagaccgccggcggagtgatgagtgtgctgatcaagcgtaacaccaccatt
cccaccaagcagacccagaccttcaccacctattcggacaaccagcccggtgtgctcatc
caggtttatgagggcgagcgtgccatgaccaaggacaataatctcttgggcaaattcgag
ttgtcgggcattcccccagcaccacgtggtgtgccccagatcgaggtcaccttcgatatc
gatgccaacggtatcttgaatgtcaccgccttggagcgttctaccaacaaggagaacaag
atcaccatcaccaacgacaagggtcgtctgtccaaggaggatatcgaacgcatggtcaac
gaggccgagaaataccgcaacgaggatgagaaacagaaggaaaccattgccgccaagaac
ggcttggagtcttactgcttcaacatgaaggctaccctcgatgaggagaatctgaagacc
aagatctcggactctgaccgcaccaccattttggacaagtgcaacgacaccatcaagtgg
ctggatgccaatcaactggccgataaggaagagtatgagcaccgtcagaaggagctcgag
ggtgtttgcaacccaatcattaccaagttgtaccagagcgctggtggtgctcccggcggt
atgcccggtgctccccccggtgctgctggtccaggtgccgcccctggtgccggagccggc
ggtgctggccccaccatcgaggaggtcgactaa

DBGET integrated database retrieval system