KEGG   Drosophila willistoni: 6647539Help
Entry
6647539           CDS       T01067                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dwi  Drosophila willistoni
Pathway
dwi00450  Selenocompound metabolism
dwi00970  Aminoacyl-tRNA biosynthesis
dwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    6647539
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    6647539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dwi01007]
    6647539
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dwi03016]
    6647539
Enzymes [BR:dwi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     6647539
Amino acid related enzymes [BR:dwi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   6647539
Transfer RNA biogenesis [BR:dwi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    6647539
 Prokaryotic type
   Other AARSs
    6647539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 6647539
NCBI-ProteinID: XP_002070684
FlyBase: FBgn0212905
UniProt: B4N9J4
Position
Unknown
AA seq 581 aa AA seqDB search
MLRSRIKQQLRQWGRRYTSSHYVTTPIFYVNAAPHIGHLYSAVIADAHCRYQRLRHPNAD
VLLCTGTDEHGTKIQQAAAGHKVPVGQYCDEISQRYRDVFQAAHIQNDDFIRTTEERHKQ
AVSHFWRKLHDNGHIYSAAYSGWYCVSDEVFLTDSQLRLDEASGMRYSLESGHPVEWTEE
TNYMFRLSQFQDDVRHWVKQEARIRPAKFEKILLDTLSEPLPDVSVSRPSNRVHWAIPVP
GDDSQTVYVWLDALVNYLSSLGYPNEKFAKHWPPAQQIIGKDILKFHGIYWPAFLMAAGL
EPPRQLYVHSHWTVDGQKMSKSKHNVVDPVKAAQEYTMEGLRYFLLREGVAHSDGNYSHV
KALRILNSELADTLGNLLSRACAKSLNPTQIYPALHSEELTELLHNLDAAKRLEESLLQL
AERCQQHYECNHFHLVADTTMATLHAANNFFESSKPWELKGGINAQRLETIIGMTMDVLR
LCGIVLQPIIPQLATQLLDKLSLPGSQRCWSRLSESFATDGNCNGNGIGQDQGKGSRQLD
GQTSALLFQRIVEKKLDKSTQKPQPAKRSKSKKERTKATAP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggagcagaataaagcagcagcttagacaatggggaaggcgctacactagctcc
cattatgtgactacaccgatattttacgtaaatgcagctccacacattgggcacctgtac
tcggcggttatagccgatgcccactgtcgttatcagaggctacgccatccaaatgctgat
gtgcttctctgcacaggaacagatgagcatggaactaaaattcaacaggcggcagctgga
cacaaggtgccagttggtcaatattgtgatgaaatatcgcaacgttatcgagatgtcttc
caggctgcgcacatacaaaacgatgatttcatacgtaccacagaggagcgccacaaacag
gccgtttcccatttctggcgtaaactacatgacaatggtcatatctattcggctgcatac
agtggctggtattgcgtgtccgatgaggtcttcctcaccgactcgcaattgcgtttggat
gaggccagtggcatgcgttactccctcgagtcgggtcatcctgtcgagtggacagaggaa
accaattacatgttccgcttgtcgcaatttcaagatgatgtgcggcactgggtcaaacag
gaggcacgcatacgaccagccaaattcgaaaagattcttttggatactcttagtgagcca
ttgcccgatgtgtccgtatcgcgaccctcgaatagggtacactgggccataccagtgccg
ggcgatgattctcaaactgtctatgtgtggctggatgctctagtcaattatctcagctcc
ctgggctatcccaatgagaagtttgccaaacactggccaccagcacagcaaatcattggc
aaggatatactaaaattccatggcatctattggccggcatttctgatggccgctggctta
gagcctccccgccagctctatgtgcattcacattggactgttgatggccaaaaaatgtcg
aagagcaagcacaatgttgtagatccagttaaagctgcccaggaatacaccatggaggga
ctacgctattttctgctgcgtgagggcgtagctcacagcgatggcaattatagccatgtg
aaggcgctgcgtatactcaattccgagctagcggacactttgggcaatttgttatcgcgc
gcctgtgccaagtcgttgaatcccacgcaaatctatccggccctgcattctgaagagttg
acggagttgctgcacaacttggacgcagccaagcgtctggaagagtcgctgctgcaactg
gcagaacgctgccaacaacattatgagtgcaatcacttccacttggtggcggacacaact
atggcgacgctgcatgcggccaacaatttctttgagtcctcgaaaccctgggaactgaag
ggtggcatcaatgcacagaggctggagacgataatcggaatgacaatggacgtgttgcgg
ctatgcggcattgtgcttcaacccataattccgcagctggccacacagctgctcgataag
ctgagcttgcctggctcgcaacgctgttggagtcgtctgagcgaaagtttcgccactgac
ggcaactgtaatggcaatggcattggccaggatcagggcaagggtagtcgtcagttggat
gggcaaactagtgccttgcttttccagcgcattgtcgaaaagaagctggataaatcaaca
caaaagccacagccagccaagcgcagcaaatcaaagaaggagcgaacgaaggcaactgct
ccgtag

DBGET integrated database retrieval system