KEGG   Drosophila willistoni: 6648687Help
Entry
6648687           CDS       T01067                                 

Definition
(RefSeq) ubiquitin-like modifier-activating enzyme 5
  KO
K12164  ubiquitin-like modifier-activating enzyme 5
Organism
dwi  Drosophila willistoni
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dwi04121]
    6648687
Ubiquitin system [BR:dwi04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   6648687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ThiF 2-Hacid_dh_C UDPG_MGDP_dh_N ECSIT NAD_binding_7 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 6648687
NCBI-ProteinID: XP_002071865
FlyBase: FBgn0212233
UniProt: B4NDE5
Position
Unknown
AA seq 406 aa AA seqDB search
MSAIDELQALIVELKSELEAQKTETRQQQAQAQQARQRIDRMSAEVVDSNPYSRLMALQR
MNIVKDYERIREKTVAVVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPD
QAGLSKVEAAARTLTFINPDVKIETHNYNITTVDNFDNFLTTISQSGTEPGTPVDLILSC
VDNFEARMAINAACNEHSLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDE
RTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALNDFFPKMTLKPNP
QCDDRHCLLRQKEFQTKPKPVKKEVEIVAEEPLHATNEWGIELVAEDAPATEDADEPKPI
VSDIGEGLRLAYEAPSKSTETTSEATTTTTGDETSLDDLMAQMKSM
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcgatgaactgcaagcccttatagtcgaactcaagtccgagctagaggca
caaaagaccgaaacacggcagcaacaggctcaggctcaacaggcacgccaacgaattgac
cgtatgtcggctgaggtggtggactccaatccatatagccgtctgatggcattgcagcgc
atgaacattgtcaaggactacgaaagaataagagaaaagacagttgccgttgtgggtgtt
ggcggtgtgggcagtgtaacagccgatatgctaacacgctgcggcattggcaaactaata
ctcttcgactatgacaaagtggagctagccaatatgaatcgtttgttcttcacacccgac
caggcgggtctaagcaaagtggaggcagctgctcgcaccttgacattcatcaatcccgat
gtgaaaatcgagacacacaactataatattacgactgtggataattttgataacttttta
acaacaatttcacaaagcggcaccgaaccaggtactccagtagacctaattttaagctgt
gtggataatttcgaagcacgtatggccatcaatgcagcctgcaatgagcactcgctcaat
tggttcgagtccggagtatcggagaatgctgtctctggacacattcagtttatccgtccc
ggcgacaccgcctgttttgcctgcgccccgcctttggttgttgccgagaacatcgacgaa
cgcacattgaagcgagagggcgtttgtgctgcttccctgcccaccactatgggcattacg
gccggctttctcgtacagaatgctctcaaatatttactcaactttggcgaagtttccgac
tatttgggttacaatgctctcaacgatttctttccaaaaatgacactcaaacccaatcct
cagtgcgatgatcgtcattgtttattgagacaaaaggagttccagactaagcccaagccg
gttaaaaaagaggtggaaattgtggctgaagaacctttgcatgccaccaatgaatggggc
attgaactggtagccgaagatgcacctgcaactgaagatgcagatgaaccaaaacccata
gtatcggatatcggagaaggtttgcgtttggcatatgaagctccaagcaagtcaacggaa
acgacatctgaggcaacaacaacgacaaccggcgatgagacaagtctggacgatttaatg
gcacaaatgaaatcaatgtga

DBGET integrated database retrieval system