KEGG   Drosophila willistoni: 6648998Help
Entry
6648998           CDS       T01067                                 

Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
dwi  Drosophila willistoni
Pathway
dwi00562  Inositol phosphate metabolism
dwi01100  Metabolic pathways
dwi04070  Phosphatidylinositol signaling system
dwi04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    6648998
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    6648998
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6648998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dwi01009]
    6648998
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     6648998
    3.1.3.64  phosphatidylinositol-3-phosphatase
     6648998
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     6648998
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    6648998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 6648998
NCBI-ProteinID: XP_002071303
FlyBase: FBgn0227679
UniProt: B4NBT0
Position
Unknown
AA seq 1297 aa AA seqDB search
MDFMVPIHNIMSDGSPPPSICFIRAAESYPKTQMEKEDSQLFVPFQELAGESIKYLGRTD
DGVLALSNYRIFLSKESTAFETYVPLGLIESVQVRDLFQLFVNCKDASTVRCSFQSAEQC
SEWQRRIQLLIGVPETLETLFAFPFYSWTCDHQIGQANGVSGTKVERAASLTNGSCTHSK
SSANIENESFSASNRLQRATRYDTDFKNEVSRLGFDLKGSWRISTANADFKLCPSYPQKL
LVPCCITDEMLHNVANFRGSRRLPAVVWRHQKSGAILARCSQPEVGWLGWRNTKDEQLLK
ALADACAFDRGEHARRSSATATATASASASASAAAMQQQQQQTKSSKDTNGQSSSSGKSS
PSLEDSSHEELALDEIRKILIVDARSYTSAVTNRARGGGCECIEYYPCAEIEFMNLGNIH
AIRKSFHAVRQLCASSPDDPNWFGQLEKTMWMQHLSGLLGATMTVVHTIEKNGRPVLVHC
SDGWDRTPQIVATAQLCLDPYYRTVEGFRVLVEREWLNFGHKFADRSGNGPHSDEVNERC
PVFLQWLDLVHQIHRQYPCSFEFSIGYLIKLAQHSLSCLFGTFLCNSLRERIESSVFDRT
FSVWPFLAETMYRNPLYKHETEKVLWPAHSVRFLYFWSDLYLGSLGNKNGTDLPLQSNER
QNPHNGSSMTKTRSSEDITTSELGQSTFSRRSSDPNLAVESIVSDSLNVNSNSMFDIRSR
SGSEANNGVYDRDVVDNKSDARHPAERNNVDNDNCATNITSEFYNNDQSTKASSHDDILL
FEATSQSISQELANSLQQMDSVSQTPGPQSQPQPSIDSSEMMPSSETAMAADHGPSSSFN
KQQTTSDISHSLWHGPIDTSTDTLIPIEPMQNVRIGNQSENDDDDDDIVDAKETKTKSST
ETECNSTISTIVQQTNKMVDQSYNNLPRVHVKPNNLRYLQKSLASDHLLDHLDLHVTRES
SNDADDDEHSAKTANVSAVNGAGRTNTNGTGTNDGNSSSVDERICLSPELHRLNSQSQNI
FSPFEMPMPSNGNRVRRNTFGSSHSRDLAHLKYTENSSTNHHFPSPGVISLPPTPQGFQE
RTQFTISCPDGLAHGLSEQNIRLHQIVQEHKLREEILLREIHGMRIALLQKGCPSCNSVV
SANVEHENGSDIVENASTCSWEAVEERSGPSSYAPSSIQEKKVSSVLWVPDHAVSRCSNC
QIEFWLGRRKHHCRSCGEIFCADCSEYWAPLPYEKLFNPVRLCGSCYTAVTTATAAATTT
TTTTTIGTSTHVQDYPANSADQIISTDHDTAKPSANS
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atggattttatggtgccgattcataatataatgtcagatggatcaccgcccccgtcgatt
tgttttatacgtgccgccgaatcttatccaaaaacgcaaatggagaaggaagactcacag
ctgtttgtaccatttcaagaacttgccggcgagtccattaaatacttaggacgaaccgat
gatggggtactcgccttgtccaattatcgcatatttctatcaaaagagtcaactgcattt
gagacatatgtgccactaggcctcatcgaatcggtccaagttcgtgatctattccaattg
tttgtcaattgcaaggatgccagcacagtcagatgctcatttcagtcggctgagcaatgc
tctgaatggcaacgacgcattcaattgctaatcggtgtacctgagacgcttgaaacgcta
ttcgctttcccattctactcctggacctgtgaccatcaaattggccaagcgaacggcgtt
agcggtaccaaagtagaacgtgccgcctcgctaacaaatggcagttgcacgcattcaaaa
tcttcggccaacattgagaatgagtcgtttagtgcaagtaatcgcttacagcgggccaca
cgatatgatacggatttcaagaatgaggtatcccgtttgggtttcgatttgaagggctcg
tggcgtatatcaacggcgaatgctgatttcaaattgtgtccatcgtatccacaaaagtta
ttagttccttgctgcattaccgatgagatgctgcacaatgtggccaattttcgtggatca
cgacgcctgccggctgtggtctggcgtcatcagaaatcgggtgctatactggcacgttgc
agtcaaccggaagttggctggctgggatggcgaaataccaaagatgagcaattgctcaaa
gctttggccgatgcgtgtgcatttgatagaggagaacatgcaaggcgttcatctgccacc
gccaccgccacagcctccgcctctgcttctgcttctgccgctgctatgcagcaacaacaa
caacaaacaaaatcttcaaaagatacaaatggccaatcgagctcatcgggcaaaagttca
ccatcattggaagattcgtcacatgaagagctggcattggatgaaataaggaaaattctt
atagtcgatgcgcgaagctacacatcggcggttacaaatcgggctcgaggcgggggttgt
gaatgcattgaatactatccatgtgccgaaatagaatttatgaatttgggaaatatacat
gctatacgaaaaagttttcatgctgtacgacaattgtgcgcatcatcacccgatgatcca
aattggtttgggcaattggagaaaaccatgtggatgcagcatctatctggcttattgggc
gcaaccatgacagtagttcacaccattgagaagaatggccgacccgtactggtgcattgc
tcggatggatgggatcgaacgccacaaatagtggcaacagcgcaactctgcctggatccg
tattatagaacagttgagggtttccgtgtactggttgagcgtgagtggttaaactttggt
cacaaatttgccgatcgctctggcaatgggccgcattcagatgaagtaaacgaacgatgt
cccgtattcctgcaatggttagatttggtacatcaaatacatagacaatatccgtgcagt
tttgaattcagcattggctatttgattaagctggcacagcactcactgtcatgtctgttt
ggcacgttcctatgtaattcgctgagagaacgaattgagagttccgtttttgaccgcaca
ttttctgtatggccatttttagcggaaactatgtatagaaatccactctataagcatgag
actgaaaaggttctttggccagcgcacagtgtgcgatttttatatttttggtctgatcta
taccttggtagtttaggtaataaaaatggtactgatcttccattacaaagtaatgagagg
caaaatccacacaatggatcgtcaatgactaaaacacgatcatctgaagacatcacaaca
agtgaattgggacagagcactttttcgagaagatcaagtgatccaaatttggccgttgaa
tctattgtttcagacagtctaaatgtgaacagtaactcaatgtttgatatacgatctaga
tctggatctgaggcaaacaatggtgtctatgatagagatgtcgtggataacaaaagcgat
gcgaggcatcctgcggaacgaaataatgtggacaatgataattgcgctaccaatattacc
tcagagttttataataatgaccaaagtaccaaagcttctagccatgatgatatattatta
tttgaagcaacatcacaatcaataagccaagagttggccaacagtttgcaacaaatggat
tcagtttcccaaactccaggaccacaatcacaaccacaaccatcaatcgactcaagtgaa
atgatgccgagcagcgagacggcgatggctgcagatcatggtccttcttcttcttttaac
aaacaacaaacaacaagtgatataagccattccctatggcatggcccaattgatactagc
acagataccttaattcctatagaacccatgcaaaatgtacgaattggcaaccaatctgag
aatgatgatgatgacgatgatatcgttgatgcaaaagagacaaagacaaagagttcaacg
gaaacagagtgcaattccacaatttcaacaattgtccagcaaaccaataaaatggttgat
caaagttacaacaatttgccgagagttcatgtgaagcccaataatctgcgatatttacaa
aaaagtcttgcaagtgaccatttgctagaccatttggatcttcatgtaaccagagagagc
agcaatgatgcggatgatgatgaacattcagctaaaactgcaaatgtcagtgcagtgaat
ggagcaggaagaacgaatacaaatggaacgggtacaaacgatggtaattcttcttctgtt
gatgagcgcatttgtctctcgcccgaacttcacagattgaatagtcaatctcaaaatata
ttctcaccattcgaaatgccaatgcctagcaatggcaatcgagtgcgtaggaacacattt
ggttccagtcatagcagagatttagcccacttaaaatacacagaaaatagcagtacaaat
catcattttccatcgccgggagttatatcattgccacccactccacaaggttttcaggaa
cgaacgcaatttacgatatcctgtccggatggtttggctcatggtttgagtgaacaaaat
attcgacttcatcaaattgtacaagaacacaagctacgcgaagagatcctcctgcgtgaa
attcatggcatgcgaattgcattactgcagaaaggatgtccaagttgcaatagcgttgta
tcggcaaatgtggaacatgaaaatggatctgatatcgttgaaaatgcatcgacatgttct
tgggaagctgtagaagagcgtagtggtccctcatcgtatgctccttcctcaatacaagag
aaaaaagtttccagtgtcctttgggtaccagatcatgcagtttcacgttgctcaaattgt
caaattgaattctggcttggacgaagaaaacatcattgtcgatcatgtggagaaattttc
tgtgctgactgttccgagtattgggctccgttgccatatgagaagctttttaatccagtc
cgactctgtggctcctgttatacggcagtgacaacagcaactgcagcagcaacaacaacc
acaacaacaacaacaataggaacatccactcatgtacaagattatccagctaattcagcc
gaccaaattatatcgactgatcatgatacagcaaagccttctgcaaattcctaa

DBGET integrated database retrieval system