KEGG   Drosophila willistoni: 6649546Help
Entry
6649546           CDS       T01067                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
dwi  Drosophila willistoni
Pathway
dwi00230  Purine metabolism
dwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6649546
Enzymes [BR:dwi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     6649546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 6649546
NCBI-ProteinID: XP_023035552
Position
Unknown
AA seq 795 aa AA seqDB search
MYGFVNYALELLVLKHFGEELWEKIKKKAMVSMEGQFLVRQIYDDEITYNLIGAAVEILN
IPADDILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQNLDALHDHLGTLYPGMRAPSF
RCTEQDGELLLHYYSERPGLEHIVIGIVKAVASKLHGVEVEIDIVKRKGEPIDEAEKQRA
LAREQLQQQLDTTNEVTAPRDNAAGPDAERNNNQNANNSINVASNSSNINNNNDGQQSSV
QCEAESSSGLPLPQDSFDCDGDKEQKCLRLLKNKSDDIERYDHVQFLIREINVAAKTQAD
AKKDEVAAAGNDDMDFLCEAPLISPATFCKVFPFHLMFDRQMKIVQAGKAVSRVIPRVAE
ENCSLIEVVEAIRPHLQLTFENILSHINTIYVLQTRQGAMSSRHEQRFLRLKGQMMYIPE
SEHYPDRILFQCYPSVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTKNLEM
LTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDFVTLMFSGIVGFG
QYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLPDPCED
HAKCIARVALDMMDMAKNVKMGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTS
RTETTGVPGRINVSADTYRLLCQEINQDDSFHLEYRGPVIMKGKPTPMDCWFLTRASSTI
ASGSGSASMATTSGNGSLDSPTAMPSQRMTHASVSRTSSGAGAGAGAAAGAGVGAGAGSS
GSAGGATTTAVPRDT
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttttgttaactatgccttggagctgcttgtgctcaagcattttggcgaggaa
ctgtgggagaaaatcaagaaaaaggccatggtcagcatggaggggcagtttttggtgcga
caaatttatgacgatgaaataacatacaatttaattggagcagctgtggaaatactgaat
ataccagccgatgatattttagagctgtttggcaaaacattctttgaattctgtcaggat
tcgggatatgataagattctgcaagtacttggcgccacacctcgtgactttttgcagaat
ctcgatgccttgcacgaccatctgggcaccctgtatcctggaatgcgagctccctcattt
cgatgcacagaacaagatggtgaactgttgctccattattactccgaacgtcctggactc
gagcacattgtcattggaatcgtgaaggctgttgcatcgaaactgcatggagttgaggtg
gaaatcgacattgtcaagcggaaaggtgaaccaatcgatgaggcggagaaacaacgggct
ttggctcgcgaacagctacagcagcaattggataccacaaatgaggtgacagctccccgg
gacaatgccgctggaccagatgccgagcggaataataatcagaatgccaacaacagtatc
aacgtggccagcaatagcagtaacatcaataacaacaacgatggccaacagagtagtgtc
cagtgtgaggcagagtcctcttcaggcttacctctaccacaggatagctttgactgtgat
ggggataaagaacagaaatgtttgcgcctgctgaaaaacaagagcgatgacatcgaacgc
tatgaccatgtgcaattcctgatacgtgaaatcaatgtggcggccaaaacgcaagcggat
gccaaaaaggacgaagtggcagccgccggcaacgatgacatggatttcctatgcgaagct
cctctaatatcacctgccacattttgcaaggttttccccttccatctaatgtttgataga
caaatgaaaattgtgcaggcaggcaaggcggtttcacgtgtaatacccagggtggccgag
gagaactgttcgttaatagaagtggttgaggctattcgaccccatctgcagctaacattc
gagaacattctgtcccacataaacaccatctatgtcctgcagacgcgacagggagccatg
agtagccggcacgagcaacgctttctcagactgaagggccaaatgatgtatataccagaa
tcggaacactatccagatcgtatactgtttcaatgttatccaagtgttatgaatttagat
gatctaaccaaaaagggactatacatttccgatgttccattgcacgatgcggccagagat
ttggttttgctctctgagaaatttgaggcggagtacaaactgaccaagaatctggaaatg
ctgacggataagctgcagcaaacatttcgtgatctggagagtgagaaacagaaaacggac
aggctcctctactcggtgctgcccaagtcagtggcgaatgagttacgacatcagcgtcca
gtgccacccaagcgctacgatttcgtgacgttgatgttctctggcatagtgggctttggc
caatattgtgccgccaacacagatcccgatggggccatgaaaattgttaaaatgcttaac
gagctctacacagtcttcgatgcccttaccgattccaagcgcaacttgaatgtttataag
gttgaaacagtcggtgataagtacatggccgtttcgggtctgcctgacccctgtgaggac
catgcaaagtgcattgctcgcgttgccctggacatgatggatatggcaaagaatgtgaaa
atgggctccaatcctgtgcaaatcaccattggcattcattcgggcgaagtggtgacaggc
gtcatcggcaatcgagtgccacgttattgtctctttggcaataccgttaacctaactagc
cgcaccgagacgaccggtgtgcccggccgtattaatgtcagcgcggacacttatcgacta
ctatgccaggagatcaatcaggatgactcgtttcatctggaatatcgaggccccgttatc
atgaagggcaagccaacgcctatggattgttggttcttaactcgtgccagcagcacaatt
gcaagtggaagcggaagtgcaagcatggctacaaccagcggcaatggcagcttggattcg
ccaacggccatgcccagccagcgaatgactcatgcaagtgtctcacgtacttcatccgga
gcaggagccggagcaggagcagcagcaggcgcaggagtaggagctggtgctggaagtagt
ggttctgccgggggagcaacgacaactgcagttccaagagatacatag

DBGET integrated database retrieval system