KEGG   Drosophila willistoni: 6650372Help
Entry
6650372           CDS       T01067                                 

Definition
(RefSeq) major heat shock 70 kDa protein Ab
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dwi  Drosophila willistoni
Pathway
dwi03040  Spliceosome
dwi04141  Protein processing in endoplasmic reticulum
dwi04144  Endocytosis
dwi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6650372
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6650372
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6650372
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6650372
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dwi01009]
    6650372
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dwi03041]
    6650372
   03009 Ribosome biogenesis [BR:dwi03009]
    6650372
   03110 Chaperones and folding catalysts [BR:dwi03110]
    6650372
   04131 Membrane trafficking [BR:dwi04131]
    6650372
   03051 Proteasome [BR:dwi03051]
    6650372
   03029 Mitochondrial biogenesis [BR:dwi03029]
    6650372
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    6650372
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     6650372
Spliceosome [BR:dwi03041]
 Complex B
  Other components
   Prp19 complex
    6650372
 Complex C
   Prp19-CDC5 complex
    6650372
Ribosome biogenesis [BR:dwi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    6650372
Chaperones and folding catalysts [BR:dwi03110]
 Heat shock proteins
  HSP70 / DNAK
   6650372
Membrane trafficking [BR:dwi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    6650372
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    6650372
Proteasome [BR:dwi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    6650372
Mitochondrial biogenesis [BR:dwi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    6650372
Exosome [BR:dwi04147]
 Exosomal proteins
  Proteins found in most exosomes
   6650372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A Phage_lysozyme FGGY_C DUF4795
Motif
Other DBs
NCBI-GeneID: 6650372
NCBI-ProteinID: XP_002072686
FlyBase: FBgn0215744
UniProt: B4NI90
Position
Unknown
AA seq 642 aa AA seqDB search
MPAIGIDLGTTFSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP
RNTVFDAKRLIGRKYDDPKIAEDIKHWPFKVVSDGGKPKLGVEFKGEPKRFAPEEISSMV
LAKMKETAEAYLGQSITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVTHLA
DEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEVDALFEGQDFYTKISRARF
EELCADLLRNTLQPVDKALNDAKMDKGQIHDIVLVGGSTRIPKVQSLLQQFFNGKSLNLS
INPDEAVAYGAAVQAAILSGDQSGKIQDVLLVDVAPLSLGIETAGGVMTKLIERNCRIPC
KQTKTFSTYADNQPGVSIQVYEGERVMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDMDA
NGILNVTAKEMSTGKAKNITIKNDKGRLSQADIDRMVSDAERYADEDEKQRLRISSRNSL
ESYVFNVKQAVEQASADKLSVTDKTSVIEKCDETIKWLDTNTTAEKEEFDHKLEELTKHC
SPIMTRMHQSASHPAGAGSGANCGQQAGGFGGYSGPTVEEVD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaattggaatagatttgggtaccacgttctcctgtgtgggtgtctatcaacat
ggaaaggtggagattatagccaatgaccagggcaaccggacgacgcccagttatgtggca
ttcaccgactcggagcgcctgataggggatgcagctaagaaccaggtggccatgaatcca
agaaacacagtattcgatgctaaacgtttgataggccgcaagtacgacgatcccaagata
gccgaggacatcaagcactggccattcaaggtggtcagcgatggaggcaagccaaagttg
ggagttgagtttaaaggcgagccgaagcgtttcgcgcccgaggagattagttcgatggtg
ctggccaagatgaaggagacagctgaggcttacttgggccagagcatcacagatgcagtc
atcacagtgccagcctacttcaacgactcccagaggcaggccaccaaagatgcgggccat
attgctggtcttaatgtgctgagaatcataaatgagccaacggcggcggctttggcctat
ggcctggacaagaatctcaagggagagcgaaatgtgttgatattcgacttgggaggcggt
acttttgatgtatccattcttactattgatgaaggatctctgtttgaggttcgcgccact
gccggcgacacacatcttggcggagaggactttgacaaccgactagtgacacatttggca
gatgaattcaagcggaagtataaaaaggacctgcgctcaaatccacgggcactgcggcgc
cttcgcacagcggctgagcgtgccaagcgcaccctgtcatccagcacagaagccaccatt
gaggtggatgcattgttcgaaggacaagacttctacactaaaataagtcgtgcccgattt
gaggagctgtgtgccgacctcttacgcaacaccctacagcctgtggataaggctctgaat
gatgccaagatggacaagggacaaatccatgacattgtacttgtgggcggctccacccgg
attcccaaggtgcagagcctgctccaacagttcttcaacggaaagagtctgaacctctcg
atcaacccagacgaagctgtggcatatggagctgctgtccaagctgctattctcagtggc
gaccagagcggcaagatccaggacgttcttctggtggatgtggcaccactctcacttggc
atagagactgctggcggagttatgaccaaattgatcgaacgcaattgccggatcccctgc
aagcaaaccaaaacgttctccacctatgccgacaatcagcctggagtttctattcaggtg
tacgagggcgaacgagtgatgaccaaggacaacaatgccctgggaaccttcgatctgtct
ggaattcctccggcacctagaggagttccccaaatagaagtcacattcgacatggatgcc
aacggaatactcaatgtcaccgctaaggagatgagcacgggcaaagccaagaatatcaca
atcaagaacgacaagggacgcctgtcgcaagctgatatcgaccgaatggtgagcgatgcg
gagcgttatgctgatgaggacgagaaacagcgcctacggatctcttcccgtaacagcttg
gaatcttacgtctttaacgtgaaacaggctgtggagcaggccagtgccgacaaactcagc
gtaacagacaagacctccgtgattgaaaagtgtgacgagaccattaaatggctggatacg
aacaccacagccgaaaaagaagagttcgaccacaaactggaggagctcaccaaacactgt
tccccgatcatgacacgaatgcatcagtccgccagtcatccggccggagctggatctggt
gccaactgtggtcagcaggctggcggatttggtggctattctggacccactgttgaggaa
gtcgactaa

DBGET integrated database retrieval system