KEGG   Drosophila willistoni: 6651084Help
Entry
6651084           CDS       T01067                                 

Definition
(RefSeq) probable pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dwi  Drosophila willistoni
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dwi01009]
    6651084
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     6651084
Protein phosphatases and associated proteins [BR:dwi01009]
 HAD phosphatases
  Other HAD phosphatases
   6651084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-GeneID: 6651084
NCBI-ProteinID: XP_002073102
FlyBase: FBgn0215340
UniProt: B4NKF8
Position
Unknown
AA seq 238 aa AA seqDB search
MVEEKDVVQGEKLKPVTHCIFDLDGLLLDTETIYEEVTAEIAAKYGKTYTVDTRFRVMGT
TYRRSAEIVIEECELPITVDEYLDQYMRMCAERVLTVPLLEGAERLLRHLHATKIPFALG
TSSGAEMVQLKTTNHRELFTLFDHLVCGSTDKDVKNGKPAPDIFLIAASRFKDPPAPEKC
LVFEDSPNGVQAGLNAGMQTVMVPDSRLSTDSCLHSTQVITSLKNFKPEQFGLPPFTD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggagaaggatgttgtccagggggagaaactaaaaccagtgactcattgcatc
tttgatctggatggattgttgttggacaccgagacaatttacgaggaggtcactgcagaa
attgcggccaagtatggcaaaacctatacggtggacactagatttcgtgtgatgggcact
acctatagacgttctgccgaaatagtcatcgaggaatgcgagctgcccatcacagtggat
gaatatctggatcagtatatgcgaatgtgcgccgagcgtgtacttactgttcccttgctt
gaaggtgccgaaaggcttttgcgtcatttacacgcaactaagataccattcgctttgggc
actagttcgggggctgaaatggtccaactaaagacaacaaatcatcgtgagttgtttacc
ctgttcgatcatcttgtctgtggctctaccgataaggatgtaaagaatggcaagccagct
ccagatatattcctaattgccgccagtcgttttaaggatccaccagctccagagaaatgc
ttagtttttgaggattcacccaatggtgttcaagctggtctaaatgctggcatgcagact
gtaatggttcccgattcccgtctctctacagattcctgcttgcattcgactcaagtaata
acctccctcaagaattttaaaccagaacaatttggtttaccaccatttaccgattga

DBGET integrated database retrieval system