KEGG   Drosophila willistoni: 6651588Help
Entry
6651588           CDS       T01067                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1 isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
dwi  Drosophila willistoni
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dwi01001]
    6651588
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     6651588
Protein kinases [BR:dwi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   6651588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 APH
Motif
Other DBs
NCBI-GeneID: 6651588
NCBI-ProteinID: XP_023035773
FlyBase: FBgn0215609
Position
Unknown
AA seq 437 aa AA seqDB search
MPLFGKKDSGKKAKAKDVKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDTPGEHFAV
KIIDKKALKGKEESLENEIRVLRRFSANHFDANCPNGARLTHPNIVQLLETYEDKSKVYL
VMELVTGGELFDRIVEKGNYTEKDATDLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPD
DDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCG
YPPFYDENDANLFAQILKGEFEFDSPYWDEISDSAKHFIKNLMCVAVEKRFTCKQALAHP
WISGNEASSKNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRLALSSNSGASTETAGN
GSTRVDAATTMDGATSMSGGSAPISTFEPSTHLSTQLQSEPTVEQPLCPTTANMKPAHDI
NNHQRISPNCSGSGQTN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgccactatttggtaagaaggactctggaaagaaggccaaggcgaaggatgtgaaagag
ctgaacaagcaagtgtcaatcgaggaaaaatataatctgcatggcctacttggaaccggc
gccttctcggaggtgcgtttggcagagagcaaggatacgcccggtgagcattttgcagtc
aaaattatcgacaagaaggccttgaagggtaaagaggaatcattggaaaatgaaatacga
gtgctgcgaaggttcagtgcaaatcatttcgatgccaactgcccgaacggagcgcggctc
actcatccaaatattgtgcaacttttggaaacttatgaggacaaatcgaaggtgtaccta
gtaatggaattagtcactggtggcgagctgtttgatcgtattgtggaaaaaggaaattac
actgaaaaggatgcgaccgatttgatacgacaaatacttgaggccgttgactacatgcac
gaacagggcgttgttcacagagacttaaagccagaaaacttgctctactacagtccagac
gatgacagcaaaattatgatcagcgatttcggtctctccaaaatggaagactctggcata
atggccactgcttgcggaactccgggctatgtggcacccgaagttttagcccaaaagcca
tacggcaaggcggttgatgtatggagtataggtgttatatcatacattctgctttgcggt
tatccgcctttctacgacgagaatgatgctaatctgtttgcccagattcttaaaggtgaa
ttcgagtttgattctccatattgggatgagattagcgattcggctaaacattttatcaag
aatttaatgtgtgtggctgtggagaagcgttttacatgcaaacaagcactagcgcatccc
tggatatctggaaacgaggcaagcagcaagaacattcacggcactgtgtcagagcagctt
aagaagaactttgcaaagtctcgttggaagcaagcatattatgcagccactgtgattcga
caaatgcagcgtttggcgcttagcagcaacagtggagcctcaactgaaactgccggcaat
ggcagcacacgtgttgacgcggcaacaaccatggacggagccacatccatgtcgggtgga
agtgcacctatatcaaccttcgagccatcaacacacctcagcacacaacttcagagcgag
ccgactgtggagcaaccattgtgtccaacgaccgcaaatatgaaaccagcgcacgatatc
aacaaccaccaaagaatctcgccaaattgtagtggcagtggccaaacgaactaa

DBGET integrated database retrieval system