KEGG   Drosophila willistoni: 6651732Help
Entry
6651732           CDS       T01067                                 

Definition
(RefSeq) negative elongation factor A
  KO
K15179  negative elongation factor A
Organism
dwi  Drosophila willistoni
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dwi03021]
    6651732
Transcription machinery [BR:dwi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     6651732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: K_channel_TID
Motif
Other DBs
NCBI-GeneID: 6651732
NCBI-ProteinID: XP_002074147
UniProt: B4NKG1
Position
Unknown
AA seq 1274 aa AA seqDB search
MANVRDSDTSLWLHNKLGTSNDSWINGSICSQLNKEVLRNIKECFPDLQTQVKLKLLLSF
LHIPRRLVEEWKAELEEVIEVAGLDSELWVSMLAETMKTFPATSSLNTEISDYEDTRPIF
TDMVNDLRKLVNKHSDLGMLPLECQYLNKNALISVVGQQPAPVKHFELKRKPKSAQLRTE
LLHKSADAQSSLKKASAPTIPLRSRGMPRKMTDTTPLKGIPSRMPTTGFRSATVPGSGAQ
RPNLSRTPAGRKDGGIKLIELSEQPLGYAAAKKRKREQQLEEQQKKQEQKQQAAAAAAAA
AAAATTGDAESPPADGATAETPTTPTTNNNNNSFEIKMEAQLNQSDGGVQELQDDDDLQT
SELAISKSMQSDPETPEYAAAATLNFTQATPTTPTSTVTVATKTPETPKVQKTPRTSKAK
VANNNNNNNNNNFIQTPKRIKQEIEIKSEEIIVPANIKLEKIESSPSQQQQQQRVIIQQP
SSAQRLLVRSTPQKRQNNITSNNLPAGAAAAAANSTTTTTTQVGNTTIKMEKLDIKPILR
ATSASAATSTSSTGTTTTILTPQQLRQAANPLANLPNNISVKITSAKAKAAAAAASASTS
SGSQASAQLQIHQQQTTQQQQQQPILINSSTPVILASSPSTPRAKPQPLPSSSSTTTATT
IPSQAIKTMPLSQLKTAANSGPVIISQTIIQPAKRAQQPQQPQQQQHHQQQQAGTSSAAA
AQQIQQQQPQLIVPQQAQQQPQQQQTQYILAAPQQLHQQQPQPILPTLTSFTQTRAVPQT
TTLYQTTAGGSGQTPTKILLKTSGASSVVMTPLRQQQGGTTLVSSNPPPLVATSAAMGLP
GQPQSTTLNIQNVQLPNRPVTIQPASQAAQQQHLQAQLQQQHPQHTIVANTTATQQPKLS
QVLMQPGGTVTTAGGVSTLNVSPTAGKNKTIILTQKGVILRNIGGDMYQQIPISNVGGLQ
SLGAGATLMTTTAAGPPGLVKTTPSSASLQLQQQQQQQGQHNKQILPTLIPTSSLGGQHV
IVQQQQPGNVIGNTPQQTIIRPVMANVGGSLTTLPQGLTLIQRPGQQPQLVQVQAAPSGP
QRTIITSATTAAATTAPQQQPRQQQQQQILVQQKPAPALQQRLVTSTSSASQGQQANSNA
GISRTVQVQVQTQQQQQPQQQQQPAQTQQAPQRRGLSLSNEHVHKAHEMFRKANRVSRPD
KALILGFMAGLRENPRPNSENVLIIKLGETEEKVQQDDGNTALCLVESHIRLDYNTGEWK
TFQNFRLLDQTAAS
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtacgggacagcgacacatcattgtggctgcataataaactgggtacatca
aatgattcgtggataaacggttcaatatgctcgcagctaaacaaggaggttttgcgcaat
atcaaagaatgttttcccgatttgcaaactcaagtgaagttgaaattgcttctcagtttc
ctccacataccacgccgcctggtggaagagtggaaggccgaactggaggaggttatcgag
gtggctggccttgattccgaactttgggtatccatgttggcggagacaatgaaaacattt
ccggccacaagttccctcaatacagaaatatccgattatgaagatacgcggcccattttc
acggacatggtcaatgatttgcgtaaattggttaataagcattccgatttgggtatgctg
ccactggagtgccagtatctaaacaagaatgccctgatctctgtggttggacagcagccg
gctcccgtcaagcatttcgagttgaagcgtaaacccaaaagcgcccagctacgcacagag
ctgctccacaaatccgccgatgcccaatcatcgcttaagaaggcttcagcgcccaccata
ccattgcgatcgcgtggcatgccccgcaaaatgacagacacgacaccgcttaagggcata
ccatcccgcatgccgacaacgggattccgttcggccactgtaccgggcagcggtgcccag
cgtcccaatctcagtcgtacaccagctggtcgcaaagatggtggcattaagctcattgaa
ctctcggaacagcctctgggctatgctgcagccaagaagcgcaaacgcgaacaacagctg
gaggagcaacagaaaaagcaggagcagaagcaacaggcagctgcagcggcggccgcagca
gcagctgctgccaccacgggcgatgccgagagtcctccagcagatggggcaaccgctgag
acgcctacaacacctacaaccaacaataacaataatagtttcgaaataaaaatggaggca
cagctaaatcaaagcgatggcggcgtccaggaattgcaggacgacgatgatttacaaaca
tccgaattggcaatcagcaagtctatgcaaagcgatccggaaacaccagagtatgcagct
gcagccactctcaactttacccaggctacgccgacaacacccacgtctacggtaactgtg
gccaccaagacgcccgaaactccaaaggtccagaagacacctcgaacttcaaaggccaag
gtggctaacaacaacaataataacaataacaacaatttcattcagacgccaaagcgtatt
aaacaggagattgagatcaagagtgaagaaattattgtgccagccaacataaaactggag
aagattgagtcgtcaccatctcagcagcagcagcagcaacgtgtaataattcagcagcca
tcgtccgcacagcgtcttctagtgcgcagtacgccacagaaacgacagaataacatcact
agcaacaacctgccagcaggagcagcagcagcagcggccaactcaacaacaacaactaca
acacaagtgggtaataccacaatcaaaatggagaaactggatattaagccaatactacga
gcaaccagtgcatctgccgcgacaagcaccagcagcacgggaactacaacaaccatactc
acaccgcagcaactgagacaggcagcaaatcctttggctaatttacccaataatatctct
gttaagataacctctgccaaagccaaggcagcagcggctgcagcatctgcatcaacgtct
agtggcagccaagcttcggcccaattgcagatacatcagcaacaaaccacacaacagcag
caacaacaacccattttgatcaacagttctacgcccgtcatactggcctcatcgcccagt
accccaagagcgaaaccacaacccctgcccagcagcagcagcacaaccaccgccacgacg
ataccatcgcaggccatcaaaacgatgcctctgagccagctaaagacagcagccaacagt
gggccagtaattatctcgcagaccataatacagccagcaaaacgtgcgcagcaaccgcaa
cagccgcagcagcaacaacatcatcagcagcagcaagcaggcacttcaagtgctgcagcc
gcacaacaaatccagcagcaacagccacagttgattgtaccccaacaggcccaacaacag
ccgcagcagcagcaaacgcaatatatactggctgctccacaacaactgcatcagcagcaa
ccgcaacccatcttaccgacattaacatcttttacacaaacacgggcagtgccacagact
acaacgttgtatcagacgacggcgggtggcagcgggcagactcctaccaagatattatta
aagacctcgggggcatccagtgtggtgatgacgcctctgcgacaacaacagggcgggact
acattggtctcgagcaatccaccaccattggttgccacgtcggcggccatgggcttacct
gggcaaccgcaatcgacgacactcaacattcagaatgttcaactgcccaatcgcccggtg
acaatacaaccagcctcgcaagctgcacagcagcaacatttgcaggctcagctgcagcag
cagcatccgcagcacacaattgtggccaatacaacggccacgcagcagccaaagctgtca
caagtattgatgcaaccgggcggcactgtaaccacagctggtggcgtctccacattaaat
gtatcgcccacggcgggtaagaacaagacgattatcctgacacagaagggtgtcatcctt
cgtaatattggcggcgatatgtatcaacaaattccgatcagtaatgtgggtggacttcag
agtcttggcgctggcgccactctgatgacaactacggcggcgggaccgcctggtctggtg
aagaccaccccatcatcggctagcctacaattgcagcagcagcaacaacagcaaggacag
cacaataaacagatattgcccactctgataccaaccagttcactgggtggtcagcatgtc
attgtccagcaacagcagcccggcaatgtgattggcaataccccacagcagacgattata
cgtccggttatggccaatgttggtggaagcttgaccacgctgccgcagggcctgaccttg
atacaacggccgggccaacagccgcagctggtgcaggtgcaagcggcgccgagtgggccg
cagcgtacgattatcacatcggcgactacggcagcggccaccacggcgccgcaacagcag
ccgcgccagcagcagcagcaacaaattttggttcaacaaaagccggcaccggccctgcag
caacgtttggtcacctccacgagcagtgccagccaagggcagcaagctaattcgaatgcc
ggtatttcgcgtacagtccaggttcaagtacagacccagcagcagcaacagccacaacag
cagcaacagccagcacagacgcaacaggcgcctcaacgacgaggtctttcgctttctaat
gagcatgttcataaggctcacgaaatgttccgcaaggcaaatcgtgtatcgcggcctgac
aaagctctcatcttgggcttcatggcgggtctgcgagagaatccgcgacccaattcagaa
aacgttttgattatcaaattaggtgaaacagaggaaaaagtgcaacaggatgatggcaac
acggccttgtgccttgtggaatcgcatattcgtttggactacaatactggcgagtggaaa
acattccagaactttaggttgctggatcagactgccgcctcatag

DBGET integrated database retrieval system