KEGG   Drosophila willistoni: 6653080Help
Entry
6653080           CDS       T01067                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dwi  Drosophila willistoni
Pathway
dwi00010  Glycolysis / Gluconeogenesis
dwi00562  Inositol phosphate metabolism
dwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6653080
   00562 Inositol phosphate metabolism
    6653080
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     6653080
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     6653080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Ribosomal_S19e
Motif
Other DBs
NCBI-GeneID: 6653080
NCBI-ProteinID: XP_015031938
UniProt: A0A0Q9WWA6
Position
Unknown
AA seq 450 aa AA seqDB search
MLYIWLTLLSLILLWNTTTADLGSNHETCCALTRLDIETRLSTKSPYRSIANYNDTQPHY
PGCVPTRIWATIRHGTRMPSKSVIARAQERLTVIQDMLLQQAKPKLCAKELEQLRKWSWQ
HFNPEDDEKLLMAEGENELIELAERMQLRFPSLLPDPYDPDWYYMKYTATQRTLKSAQSF
ATGLFGRHRIHTVNYPRPLHRDPILRFYKLCGRWKIDVKKNPETLVNARRFYAEPQMQSA
VDYVRSRTQLEDLQPEDVELMYTVCAFETAWQRPLGHFRPSVWCSFFDVEALNALEFVED
LEYYWNDGYGYKLSHRIACPAIADMFEAIDTPTAKANATFYFTHSGTLLKLLAHLGLAKD
EEMLTHKHFDYARQWRTSRIDAFATNLAFLRFDCEKGPHVLVLHQEQVVHLPGCPQDNDL
CPLATLRLLFRESIENCDFDTLCQINGNAN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgctatacatttggttaactctgttgtctctcatactgctgtggaacacaacaacagct
gatttgggttccaaccatgaaacatgctgtgctctgacccggttggacatcgagactcgc
ttgtccacgaagtcaccatatcgctccatagccaattacaatgatacccaaccacattat
ccaggttgcgtacctacgcgtatctgggcgactatacgccatggtactcggatgccgagc
aaatctgtgatagcccgcgcccaagaacgtttgacagtcatacaggatatgctgctgcag
caagcgaaaccaaagttgtgtgccaaggagctggaacaattgcggaagtggagctggcag
cattttaatccggaagatgatgagaaacttttgatggcggagggagaaaatgagttaatc
gagctagcagagcgtatgcaactgcgattcccttcactgctgcctgacccctatgacccg
gactggtattatatgaaatacacggcaacacagcgaacgttgaaaagcgcacagagcttt
gccacggggttgtttggacgacatcggatacacacggtcaactatccacgacctttgcat
agagatcccatactaagattttataaactctgcggccgttggaaaattgatgttaaaaag
aatcctgaaacattggttaatgcacgtagattctatgcagagccacaaatgcaatcagca
gtggattatgtgcggagcaggacgcagctggaggacttgcagccggaggacgttgaactc
atgtatacggtatgtgcctttgagacagcatggcaacgaccacttggacatttccggcca
tcggtgtggtgtagtttcttcgacgtggaagcactgaacgcactggaatttgtcgaagat
ttggaatattattggaacgatggctatggctataagttgtcacatcgcattgcctgtccg
gcaatagcggatatgtttgaggccattgatacaccgacggctaaagccaatgccaccttc
tatttcacacattcgggcacactgcttaagctgctggcccacctcggcttggctaaggat
gaggagatgctgacgcacaagcattttgattatgcgcgtcaatggcgcacaagtcgaatt
gatgcttttgcaacaaacttggcctttctgcgctttgattgtgagaagggaccccatgta
ctggtgctgcatcaggagcaggttgtacatctgcctggctgtccgcaggataatgatctc
tgtccccttgcaacgttgcgtctcctatttagggagagcatagagaactgtgactttgac
actctctgtcaaatcaatggaaacgccaattga

DBGET integrated database retrieval system