KEGG   Drosophila willistoni: Dwil_GK13114Help
Entry
Dwil_GK13114      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dwi  Drosophila willistoni
Pathway
dwi04140  Autophagy - animal
dwi04213  Longevity regulating pathway - multiple species
dwi04310  Wnt signaling pathway
dwi04341  Hedgehog signaling pathway - fly
Module
dwi_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK13114
   04341 Hedgehog signaling pathway - fly
    Dwil_GK13114
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dwil_GK13114
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dwil_GK13114
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dwil_GK13114
Protein kinases [BR:dwi01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dwil_GK13114
Messenger RNA biogenesis [BR:dwi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dwil_GK13114
Chromosome and associated proteins [BR:dwi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dwil_GK13114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 6651177
NCBI-ProteinID: XP_002073499
FlyBase: FBgn0215123
UniProt: B4NGY8
Position
Unknown
AA seq 354 aa AA seqDB search
MGVYEQQSFSSKVDYKLILDKLREEFNKKFSQNTPSLAIGLDNYEIKATLGAGSFGKVQM
VKEKSSGNYYASKQLSKDQIMKTKQVAHVMSEKRVLRSIFFPFTVYLVASFKDNDSLYLI
LPIVPGGELFTYHRKVRKFSEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMIDKNGY
LKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVYEFVAGHSPFS
SHNRDMMSMYNKICECDYKMPSYFSGSLRHLVDHLLQVDLSKRYGNLINGNKDIKDHEWF
KEIDWIPLLNQTISPPYIPTISNPEDISHFDKISEGKPKTKAKTMRHEEIFADF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctatgagcaacagagtttcagttcgaaggtcgattataaattaatattagat
aagctgagagaggagtttaataagaagtttagccaaaataccccatccttggcgattggt
cttgataactatgagatcaaggccaccctgggagctggatcatttggaaaagtgcagatg
gttaaggagaagtcctcgggaaattattatgcctctaaacaacttagcaaggatcagata
atgaagacaaagcaagtggcccatgtgatgagtgaaaagcgtgtcctacgctcaatattt
tttccattcactgtctatttggtggcttctttcaaggataatgacagtctctatctaata
ttgcccattgtgccgggaggtgaactttttacctatcaccgcaaagttcgtaaatttagt
gagaaacaagcacgtttctatgcggctcaagtatttctggccttggagtatctgcatcat
tgcagtttactctatcgtgatttgaaaccagagaacattatgatcgacaagaatggttat
ttaaaggttaccgattttggttttgccaagaaagtggaaacacgtaccatgactttgtgt
ggtacaccagaatatttgccacccgagattattcaatcgaaaccatatggcactagcgtg
gactggtgggcttttggtgtattggtctatgaatttgtcgctggacactcgccattttcc
tcgcacaatcgggacatgatgagcatgtataataagatttgcgaatgtgattataagatg
ccttcctatttcagtggttcgttacgtcatctggtcgatcatttgttgcaggtggatctt
tctaaacgatatggcaatttgattaatggtaataaggatatcaaggatcatgagtggttt
aaggaaattgattggataccgctgctgaatcaaactattagtcctccctatataccaacc
attagcaatcccgaggatatttcacatttcgataagatctccgagggcaaacccaaaaca
aaggccaagaccatgcggcatgaggagatttttgctgatttttaa

DBGET integrated database retrieval system