KEGG   Drosophila willistoni: Dwil_GK13845Help
Entry
Dwil_GK13845      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dwi  Drosophila willistoni
Brite
Chromosome and associated proteins [BR:dwi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dwil_GK13845
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK13845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6637661
NCBI-ProteinID: XP_002060811
FlyBase: FBgn0215853
UniProt: B4MHM9
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaactagtggaaaagcagccaagaaggctggcaaggctcaaaagaacatc
accaagaatgacaaaaagaagaagcgcaagcgtaaggagagctatgctatttacatttac
aaagtgttaaagcaagtccacccagacactggtatttcttcaaaagcaatgagcataatg
aatagctttgtaaacgatatttttgaacgtattgctgctgaggcctcccgcttggcccac
tacaataagaggtcgaccatcaccagtcgcgaaatccaaacggctgttcgtttgcttttg
ccgggtgagcttgctaagcacgctgttagtgagggaacaaaagctgtcaccaagtatacc
agctcaaaataa

DBGET integrated database retrieval system