KEGG   Drosophila willistoni: Dwil_GK19645Help
Entry
Dwil_GK19645      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dwi  Drosophila willistoni
Pathway
dwi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dwil_GK19645
  Infectious diseases
   05163 Human cytomegalovirus infection
    Dwil_GK19645
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dwil_GK19645
Protein kinases [BR:dwi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Dwil_GK19645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Kdo FTA2 RIO1
Motif
Other DBs
NCBI-GeneID: 6639792
NCBI-ProteinID: XP_002062797
FlyBase: FBgn0221643
UniProt: B4MNU4
Position
Unknown
AA seq 318 aa AA seqDB search
MSQSPQLKRQKMSSHSKNFGDGDPHNYQELNIIGTGAYGTVYRARDMITGNIVALKKVRI
ALNDNGVPMSTLREIALLKQLNASDHANIVKLYEVCQFLERDDQLMIVLVFEHLEQDLSD
LIERLPKSGMSPSTVQNLSRELLTGLDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA
KTYDSEMKLTSVVVTLWYRAPEVLLAQPYNSSVDVWSAACIIFEMYNRKALFPGTSEKNQ
LDRIFELTGRPSAQQWPKSISVSREHFPQRHPKRPRDFCPNLCECSDDLLKQMLDYDIRL
RPSALACLDHEYFQQEPL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcaccacaattaaagagacagaaaatgtcatcgcattccaaaaatttcggc
gatggcgatccacacaactatcaggaactcaacattataggcacaggggcctatgggacc
gtctacagagcccgcgacatgatcactgggaacattgtggccctaaagaaggtgcggatc
gctctaaatgacaacggagtgcccatgtccacgttgcgagaaattgcgctgctaaaacaa
ttgaatgccagcgatcatgccaacattgtgaaactctatgaggtctgtcagttcttggaa
cgcgacgatcaattaatgatagtattggtctttgagcatctggagcaagatttgtccgat
ctgattgaacgcttgccaaaatctggaatgtcacccagtacagtacagaacctttcccgt
gaacttttaaccggcctcgactttctgcactcacatcgcattatccatcgcgacctgaag
cctcagaatttgttggtctcgtcgcagggacatttgaaaatcgctgattttggtttagcc
aaaacatacgattcggaaatgaaactgacctcagttgttgtaacgctttggtatagagca
ccagaagtccttttggcccaaccctataacagttcggtggatgtttggagtgcagcatgc
ataatatttgaaatgtataatcgcaaggctttgtttcccggcacctcagaaaagaatcaa
ctggatagaatattcgaactcacaggacgaccctcagcccaacagtggcccaaaagcatt
tctgtgtccagagaacatttcccccaacgtcatcccaaacgtccgcgtgacttttgtccc
aatctatgtgaatgttctgatgatctattaaaacaaatgcttgactatgatatacgactg
cggccatcggccttggcttgcttagatcatgaatattttcaacaggagcctctataa

DBGET integrated database retrieval system