KEGG   Drosophila willistoni: Dwil_GK24313Help
Entry
Dwil_GK24313      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10739  replication factor A2
Organism
dwi  Drosophila willistoni
Pathway
dwi03030  DNA replication
dwi03420  Nucleotide excision repair
dwi03430  Mismatch repair
dwi03440  Homologous recombination
dwi03460  Fanconi anemia pathway
Module
dwi_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dwil_GK24313
   03420 Nucleotide excision repair
    Dwil_GK24313
   03430 Mismatch repair
    Dwil_GK24313
   03440 Homologous recombination
    Dwil_GK24313
   03460 Fanconi anemia pathway
    Dwil_GK24313
DNA replication proteins [BR:dwi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dwil_GK24313
DNA repair and recombination proteins [BR:dwi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dwil_GK24313
   MMR (mismatch exicision repair)
     Dwil_GK24313
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dwil_GK24313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon DUF4539 RNA_pol_Rpc34 DDRGK
Motif
Other DBs
NCBI-GeneID: 6643809
NCBI-ProteinID: XP_002066892
FlyBase: FBgn0226273
UniProt: B4MZU3
Position
Unknown
AA seq 239 aa AA seqDB search
MNDSFGDFNATQTAGAASEQKGEGILPMLIKQILLLPEGNIELFGMHYAMTTVVAIVRNI
ETSSTKITYTLEDHTGRLDAHYWLEEGDAHKAPDVMLNNYVRVYGTTRSQGGQKTLMVFK
ALPVLDPNEVTTHLLEVLNARYKAEAYQEKGGSSGHQNSTMPDFSASQSNALVNGLDAKQ
QAVFQAIKSNVSEEGIGRKELKGKFSHISDSELNNILEFMISEGHIYSSIDADHFICTM
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattcctttggagatttcaatgccacccagacagctggcgctgcatcggagcag
aagggagagggaatcctccccatgctaataaagcagattctccttctgcccgagggcaat
atcgagctatttggcatgcactatgccatgaccacagtggttgcaattgtgcgcaatatt
gagacatcctcgaccaagataacctacacgctggaggatcacactggacgtcttgatgcc
cattattggctggaggaaggtgatgctcataaagctcccgatgtcatgctgaataactat
gttcgcgtctatggcacaacacgatcccaggggggccaaaagacactaatggtgttcaaa
gcattgcccgtgctagatcccaatgaggttaccacacatcttcttgaggtgctaaatgcc
cgctacaaggcagaggcctatcaagagaagggtggttcgtcaggtcatcagaattccaca
atgcccgatttcagtgccagccaaagtaatgccctggtcaacggtttggatgccaagcaa
caggccgtattccaggccattaagagtaacgtctccgaggagggcattggtcgtaaggag
ttaaagggcaaattctctcacatcagcgattcggaattgaacaacattctggaattcatg
atctcggaaggccatatttattcaagcatagatgctgatcacttcatctgtaccatgtaa

DBGET integrated database retrieval system