KEGG   Drosophila willistoni: Dwil_GK25566Help
Entry
Dwil_GK25566      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 6649206
NCBI-ProteinID: XP_002071012
FlyBase: FBgn0227525
UniProt: B4NE29
Position
Unknown
AA seq 413 aa AA seqDB search
MPNHAIRRRHQGLLQTLTVIHITLTLLLGSVDCGLHKWHLMMNTFRYLQETMLRNSLERA
RLNYGIVFECRTISDRDFGEEVHFHLQLGDLRGFRRLDAKKKLALFLHGWNDQGSKDWVQ
ELLLTWTLFDANYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPRHFHRR
NVTLAGYSLGAHAAGYAGAVLDGEVEQIIGLDPAGPLFTLPSDVSPKYRLDPTDAQFVQV
LHTSGGTLGTSLKCGHADFYPNGGRAPQKNCRMFMNLRDMQNTNPIACSHSSAAIFFRQS
MDPEYPFVGTQCGSYREFTAGHCEGNGRARFGIHSHRRAEGSYYFDTGSQQPYVQRRRED
LWSIGRQASTRAGSGVRSGTGLRVKGKSKVIRLQIWRTGWRRRQRERNRCAFK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatcacgcgattagaagaaggcaccaaggcctgctacaaactctgaccgtcata
catatcacattgaccctacttctgggcagtgtcgattgcggcctgcacaaatggcatctg
atgatgaacacatttcgctatctgcaggagacgatgctaaggaacagcctggagcgagcc
cgtctcaattatggcattgtgtttgagtgtcgcaccatttccgatcgagatttcggcgaa
gaagttcatttccatttgcagttgggcgacttgcgtggttttcgtcgattggatgctaaa
aagaaattggcattatttctacacggttggaatgatcaaggcagcaaagattgggtgcaa
gagctcttgttgacttggactctgttcgatgcgaattacaatgtgtgtgttgtggattgg
ggaaatttgtcacaaaatgattacaagagtgcctccatgtccatatttgatgtcggccta
actgtagctggtatcataatggccctagaggaattgcgtccacggcattttcatcgacga
aatgtgaccctggccggctatagtctaggtgcccatgccgctggctatgcaggagccgtt
ttggatggcgaggtagagcaaatcattggcttggatccggctggtccactatttaccctg
ccctctgatgtgtcgcccaaatatcgtttggatcccacagatgcccaatttgttcaagtg
ttgcacacctcgggcggcactctgggcaccagtttaaagtgcggccatgcggacttctat
ccgaatggaggccgcgcaccgcaaaagaattgccgcatgtttatgaatctcagggacatg
cagaacacgaatccgattgcctgcagtcattcatcggcggctatcttttttcgccaatcc
atggatccggaatacccttttgtgggaacacagtgtggcagctatcgtgagtttacagct
ggccattgtgagggcaatggacgggcccgattcggcattcactcccatcgtagggctgag
ggtagctattactttgacacgggttcccagcagccgtatgtgcagcgtcgtcgtgaggat
ctgtggtcaattggacggcaagccagcacgagagcaggatctggagttcgatctggaaca
ggtctaagagtcaagggcaaaagcaaagttattcggctacaaatatggagaactggctgg
agaagacgacaacgtgaaaggaatcgttgtgcatttaaatag

DBGET integrated database retrieval system